YOD1 Antibody | Affinity Biosciences

1/1

Western blot analysis of extracts from COLO cells, using YOD1 antibody.

Product:	YOD1 Antibody
Catalog:	DF4597
Description:	Rabbit polyclonal antibody to YOD1
Application:	WB IF/ICC
Reactivity:	Human
Mol.Wt.:	35 KD; 38kD(Calculated).
Uniprot:	Q5VVQ6
RRID:	AB_2836961

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human

Clonality:

Polyclonal

Specificity:

YOD1 Antibody detects endogenous levels of total YOD1.

RRID:

AB_2836961
Cite Format: Affinity Biosciences Cat# DF4597, RRID:AB_2836961.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) edit item name - YOD1 OTU deubiquinating enzyme 1, S. cerevisiae, homolog of; DUBA-8; DUBA8; HIN-7; HIV-1-induced protease 7; HsHIN7; OTU domain containing 2; OTU domain-containing protein 2; OTU1_HUMAN; OTUD2; PRO0907; RP11-164O23.1; Ubiquitin thioesterase OTU1; yod1; YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae); YOD1 OTU deubiquinating enzyme 1 homolog (yeast);

Immunogens

Immunogen:

Uniprot:

Q5VVQ6(OTU1_HUMAN) >>Visit HPA database.

Gene(ID):

YOD1(55432)

Sequence:

Q5VVQ6 OTU1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

PTMs - Q5VVQ6 As Substrate

Q5VVQ6

Site	PTM Type	Source
S130	Phosphorylation	Uniprot
K135	Ubiquitination	Uniprot
S139	Phosphorylation	Uniprot
S140	Phosphorylation	Uniprot
T150	Phosphorylation	Uniprot
K257	Ubiquitination	Uniprot
K325	Ubiquitination	Uniprot

Research Backgrounds

Q5VVQ6_OTU1_HUMAN

Function:

Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel. Mediates deubiquitination of 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains. Also able to hydrolyze 'Lys-11'-linked ubiquitin chains. Cleaves both polyubiquitin and di-ubiquitin. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. May recruit PLAA, UBXN6 and VCP to damaged lysosome membranes decorated with K48-linked ubiquitin chains and remove these chains allowing autophagosome formation.

Subcellular Location:

Cytoplasm.
Note: Recruited to damaged lysosomes decorated with K48-linked ubiquitin chains.

Subunit Structure:

Interacts with VCP; the interaction is direct. Interacts with FAF2/UBXD8. Interacts with DERL1; however interaction is dependent on the UBAX-like region, suggesting that it may be indirect. Interacts with PLAA, UBXN6 and VCP; may form a complex involved in macroautophagy.

Family&Domains:

The UBAX-like region mediates the interaction with VCP. According to PubMed:19818707, it corresponds to a UBX domain, which is a hallmark for VCP-associated proteins. However, no canonical UBX is detected by prediction tools such as Pfam or PROSITE.

The C2H2-type zinc finger mediates specificity for 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains but not for 'Lys-11'-linked ubiquitin chains. Selectivity for 'Lys-11'-linked ubiquitin chains is provided by recognition of the sequence surrounding 'Lys-11' in ubiquitin. The S2 site region provides specificity for longer 'Lys-11'-linked ubiquitin chains (PubMed:23827681).

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

YOD1 Antibody - #DF4597