SYT11 Antibody - #DF4552
Product: | SYT11 Antibody |
Catalog: | DF4552 |
Description: | Rabbit polyclonal antibody to SYT11 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 48 KD; 48kD(Calculated). |
Uniprot: | Q9BT88 |
RRID: | AB_2836903 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4552, RRID:AB_2836903.
Fold/Unfold
DKFZp781D015; KIAA0080; MGC10881; MGC17226; Synaptotagmin 11; Synaptotagmin 12; Synaptotagmin XI; Synaptotagmin-11; Synaptotagmin11; Synaptotagmin12; SynaptotagminXI; SYT 11; SYT 12; Syt XI; Syt11; SYT11_HUMAN; SYT12; SytXI;
Immunogens
- Q9BT88 SYT11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWHSLSEY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BT88 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K54 | Ubiquitination | Uniprot | |
S63 | Phosphorylation | Uniprot | |
Y65 | Phosphorylation | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
T137 | Phosphorylation | Uniprot | |
Y197 | Phosphorylation | Uniprot | |
Y301 | Phosphorylation | Uniprot | |
T309 | Phosphorylation | Uniprot | |
Y331 | Phosphorylation | Uniprot | |
Y337 | Phosphorylation | Uniprot | |
Y338 | Phosphorylation | Uniprot | |
T387 | Phosphorylation | Uniprot |
Research Backgrounds
Synaptotagmin family member involved in vesicular and membrane trafficking which does not bind Ca(2+). Inhibits clathrin-mediated and bulk endocytosis, functions to ensure precision in vesicle retrieval. Plays an important role in dopamine transmission by regulating endocytosis and the vesicle-recycling process. Essential component of a neuronal vesicular trafficking pathway that differs from the synaptic vesicle trafficking pathway but is crucial for development and synaptic plasticity. In macrophages and microglia, inhibits the conventional cytokine secretion, of at least IL6 and TNF, and phagocytosis. In astrocytes, regulates lysosome exocytosis, mechanism required for the repair of injured astrocyte cell membrane (By similarity). Required for the ATP13A2-mediated regulation of the autophagy-lysosome pathway.
Ubiquitinated, at least by PRKN, and targeted to the proteasome complex for degradation. Ubiquitination is inhibited by ATP13A2.
Cytoplasmic vesicle membrane>Single-pass membrane protein. Perikaryon. Golgi apparatus>trans-Golgi network membrane>Single-pass membrane protein. Recycling endosome membrane>Single-pass membrane protein. Lysosome membrane>Single-pass membrane protein. Cytoplasmic vesicle>Phagosome. Cell projection>Axon. Cell projection>Dendrite. Cell junction>Synapse>Postsynaptic density. Recycling endosome membrane>Single-pass membrane protein. Cytoplasmic vesicle>Clathrin-coated vesicle membrane>Single-pass membrane protein. Perikaryon.
Note: Localized in vesicles that travels in axonal and dendritic shafts in both anterograde and retrograde directions. In macrophages and microglia, recruited in phagosomes at early stages of phagocytosis (By similarity). Found in the core of the Lewy bodies in the brain of sporadic Parkinson disease patients (PubMed:12925569).
Homodimer. Can also form heterodimers. Interacts with PRKN. Interacts (via C2 2 domain) with AGO2 and SND1; the interaction with SND1 is direct. Interacts with KIF1A; the interaction increases in presence of calcium (By similarity).
The second C2 domain/C2B is required for the inhibitory role in both clathrin-mediated and bulk endocytosis. The transmembrane domain and the first C2 domain/C2A are critical for the inhibitory role in clathrin-mediated endocytosis or bulk endocytosis, respectively.
Unlike in other synaptotagmin family members, the first C2 domain/C2A does not bind Ca(2+) neither mediates Ca(2+)-dependent phospholipid binding. An aspartate-to-serine substitution in this domain inactivates Ca(2+)/phospho-lipid binding.
Belongs to the synaptotagmin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.