SFRS7 Antibody - #DF4544
Product: | SFRS7 Antibody |
Catalog: | DF4544 |
Description: | Rabbit polyclonal antibody to SFRS7 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 35 KD; 27kD(Calculated). |
Uniprot: | Q16629 |
RRID: | AB_2836895 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4544, RRID:AB_2836895.
Fold/Unfold
9G8; AAG3; arginine/serine-rich 7; HSSG1; RBM37; Serine/arginine-rich splicing factor 7; Splicing factor 9G8; Splicing factor; Splicing factor, arginine/serine rich 7; SRSF7; SRSF7_HUMAN; ZCCHC20; ZCRB2;
Immunogens
- Q16629 SRSF7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16629 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y4 | Phosphorylation | Uniprot | |
Y7 | Phosphorylation | Uniprot | |
K12 | Sumoylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
Y14 | Phosphorylation | Uniprot | |
T20 | Phosphorylation | Uniprot | |
K24 | Acetylation | Uniprot | |
K24 | Sumoylation | Uniprot | |
K24 | Ubiquitination | Uniprot | |
S32 | Phosphorylation | Uniprot | |
Y33 | Phosphorylation | Uniprot | |
Y34 | Phosphorylation | Uniprot | |
K70 | Acetylation | Uniprot | |
K70 | Ubiquitination | Uniprot | |
C73 | S-Nitrosylation | Uniprot | |
R98 | Methylation | Uniprot | |
R105 | Methylation | Uniprot | |
Y107 | Phosphorylation | Uniprot | |
K112 | Acetylation | Uniprot | |
K112 | Ubiquitination | Uniprot | |
Y117 | Phosphorylation | Uniprot | |
S123 | Phosphorylation | Uniprot | |
S155 | Phosphorylation | Uniprot | |
S157 | Phosphorylation | Uniprot | |
S159 | Phosphorylation | Uniprot | |
S163 | Phosphorylation | Uniprot | |
S165 | Phosphorylation | Uniprot | |
S167 | Phosphorylation | Uniprot | |
S171 | Phosphorylation | Uniprot | |
S173 | Phosphorylation | Uniprot | |
S175 | Phosphorylation | Uniprot | |
S179 | Phosphorylation | Uniprot | |
S181 | Phosphorylation | Uniprot | |
S183 | Phosphorylation | Uniprot | |
K185 | Acetylation | Uniprot | |
S187 | Phosphorylation | Uniprot | |
Y189 | Phosphorylation | Uniprot | |
S192 | Phosphorylation | Uniprot | |
S194 | Phosphorylation | Uniprot | |
S196 | Phosphorylation | Uniprot | |
S198 | Phosphorylation | Uniprot | |
S200 | Phosphorylation | Uniprot | |
S202 | Phosphorylation | Uniprot | |
S204 | Phosphorylation | Uniprot | |
S213 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
S217 | Phosphorylation | Uniprot | |
S221 | Phosphorylation | Uniprot | |
S223 | Phosphorylation | Uniprot | |
S225 | Phosphorylation | Uniprot | |
S227 | Phosphorylation | Uniprot | |
S231 | Phosphorylation | Uniprot | |
S233 | Phosphorylation | Uniprot | |
R236 | Methylation | Uniprot |
Research Backgrounds
Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific.
Extensively phosphorylated on serine residues in the RS domain.
Nucleus. Cytoplasm.
Brain, liver, kidney and lung.
Found in large molecular weight complexes containing CCNL1 and the p110 isoforms of either CDC2L1 or CDC2L2. Interacts with CCNL2 and CPSF6. Interacts with NXF1.
Belongs to the splicing factor SR family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.