SFRS2B Antibody - #DF4543
| Product: | SFRS2B Antibody |
| Catalog: | DF4543 |
| Description: | Rabbit polyclonal antibody to SFRS2B |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 32 KD; 32kD(Calculated). |
| Uniprot: | Q9BRL6 |
| RRID: | AB_2836894 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4543, RRID:AB_2836894.
Fold/Unfold
arginine/serine-rich 2B; Pre mRNA splicing factor SRP46; Pre-mRNA-splicing factor SRP46; Serine/arginine-rich splicing factor 8; SFRS2B; Splicing factor; Splicing factor arginine serine rich 46kD; Splicing factor arginine serine rich 2B; Splicing factor SRp46; SRP46; SRSF8; SRSF8_HUMAN;
Immunogens
Strongly expressed in pancreas, spleen and prostate. Weakly expressed in lung, liver and thymus.
- Q9BRL6 SRSF8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
PTMs - Q9BRL6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S2 | Phosphorylation | Uniprot | |
| T25 | Phosphorylation | Uniprot | |
| S26 | Phosphorylation | Uniprot | |
| S29 | Phosphorylation | Uniprot | |
| R31 | Methylation | Uniprot | |
| K36 | Acetylation | Uniprot | |
| K36 | Ubiquitination | Uniprot | |
| R39 | Methylation | Uniprot | |
| Y44 | Phosphorylation | Uniprot | |
| S100 | Phosphorylation | Uniprot | |
| R106 | Methylation | Uniprot | |
| R110 | Methylation | Uniprot | |
| S134 | Phosphorylation | Uniprot | |
| S136 | Phosphorylation | Uniprot | |
| S140 | Phosphorylation | Uniprot | |
| S142 | Phosphorylation | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| S153 | Phosphorylation | Uniprot | |
| Y155 | Phosphorylation | Uniprot | |
| S156 | Phosphorylation | Uniprot | |
| S158 | Phosphorylation | Uniprot | |
| Y160 | Phosphorylation | Uniprot | |
| S161 | Phosphorylation | Uniprot | |
| S163 | Phosphorylation | Uniprot | |
| Y165 | Phosphorylation | Uniprot | |
| S166 | Phosphorylation | Uniprot | |
| S168 | Phosphorylation | Uniprot | |
| Y170 | Phosphorylation | Uniprot | |
| S171 | Phosphorylation | Uniprot | |
| S173 | Phosphorylation | Uniprot | |
| Y175 | Phosphorylation | Uniprot | |
| S176 | Phosphorylation | Uniprot | |
| S178 | Phosphorylation | Uniprot | |
| Y180 | Phosphorylation | Uniprot | |
| S188 | Phosphorylation | Uniprot | |
| Y190 | Phosphorylation | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| S192 | Phosphorylation | Uniprot | |
| S196 | Phosphorylation | Uniprot | |
| S198 | Phosphorylation | Uniprot | |
| S218 | Phosphorylation | Uniprot | |
| K233 | Methylation | Uniprot | |
| S236 | Phosphorylation | Uniprot | |
| S238 | Phosphorylation | Uniprot | |
| S240 | Phosphorylation | Uniprot | |
| R241 | Methylation | Uniprot | |
| T250 | Phosphorylation | Uniprot | |
| S252 | Phosphorylation | Uniprot | |
| S267 | Phosphorylation | Uniprot | |
| S273 | Phosphorylation | Uniprot | |
| S281 | Phosphorylation | Uniprot | |
| S282 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in pre-mRNA alternative splicing.
Nucleus.
Strongly expressed in pancreas, spleen and prostate. Weakly expressed in lung, liver and thymus.
Belongs to the splicing factor SR family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.