SF3B4 Antibody - #DF4540
Product: | SF3B4 Antibody |
Catalog: | DF4540 |
Description: | Rabbit polyclonal antibody to SF3B4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 55 KD; 44kD(Calculated). |
Uniprot: | Q15427 |
RRID: | AB_2836891 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4540, RRID:AB_2836891.
Fold/Unfold
AFD1; Hsh49; MGC10828; Pre mRNA splicing factor SF3b 49 kDa subunit; Pre-mRNA-splicing factor SF3b 49 kDa subunit; SAP 49; SAP49; Sf3b4; SF3B4_HUMAN; SF3b49; SF3b50; Spliceosomal protein; Spliceosome associated protein (U2 snRNP); Spliceosome associated protein 49; Spliceosome-associated protein 49; Splicing factor 3b subunit 4 49kDa; Splicing factor 3B subunit 4;
Immunogens
- Q15427 SF3B4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15427 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
Y16 | Phosphorylation | Uniprot | |
T42 | Phosphorylation | Uniprot | |
Y56 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
Y69 | Phosphorylation | Uniprot | |
K78 | Ubiquitination | Uniprot | |
K82 | Ubiquitination | Uniprot | |
Y117 | Phosphorylation | Uniprot | |
T129 | Phosphorylation | Uniprot | |
S141 | Phosphorylation | Uniprot | |
R390 | Methylation | Uniprot | |
R398 | Methylation | Uniprot | |
R409 | Methylation | Uniprot | |
R415 | Methylation | Uniprot | |
R419 | Methylation | Uniprot |
Research Backgrounds
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
Nucleus.
Component of splicing factor SF3B complex which is composed of at least eight subunits; SF3B1, SF3B2, SF3B3, SF3B4, SF3B5, SF3B6, PHF5A and DDX42. SF3B associates with the splicing factor SF3A and a 12S RNA unit to form the U2 small nuclear ribonucleoproteins complex (U2 snRNP). Interacts directly with SF3B2. Found in a complex with PRMT9, SF3B2 and SF3B4. The SF3B complex composed of SF3B1, SF3B2, SF3B3, SF3B4, SF3B5, SF3B6 and PHF5A interacts with U2AF2. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome.
Belongs to the SF3B4 family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.