Product: ATP1B3 Antibody
Catalog: DF4528
Source: Rabbit
Application: WB, IF/ICC, ELISA(peptide)
Reactivity: Human, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 31 kD; 32kD(Calculated).
Uniprot: P54709
RRID: AB_2836879

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Prediction:
Pig(91%), Bovine(91%), Sheep(91%), Rabbit(92%), Dog(91%)
Clonality:
Polyclonal
Specificity:
ATP1B3 Antibody detects endogenous levels of total ATP1B3.
RRID:
AB_2836879
Cite Format: Affinity Biosciences Cat# DF4528, RRID:AB_2836879.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AT1B3_HUMAN; atp1b3; ATPase Na+/K+ transporting beta 3 polypeptide; ATPB 3; ATPB-3; ATPB3; CD 298; CD298; CD298 antigen; FLJ29027; Na K ATPase beta 3 polypeptide; Na+/K+ ATPase beta 3 subunit; NKAB3S; Sodium potassium ATPase subunit beta 3 (non catalytic); Sodium pump subunit beta 3; Sodium/potassium dependent ATPase beta 3 subunit; Sodium/potassium dependent ATPase subunit beta 3; Sodium/potassium transporting ATPase beta 3 chain; Sodium/potassium transporting ATPase subunit beta 3; Sodium/potassium-dependent ATPase subunit beta-3; Sodium/potassium-transporting ATPase subunit beta-3;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
92
Pig
91
Bovine
91
Sheep
91
Dog
91
Horse
64
Chicken
45
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P54709 As Substrate

Site PTM Type Enzyme
K7 Ubiquitination
S8 Phosphorylation
S12 Phosphorylation
K17 Ubiquitination
K86 Ubiquitination
T101 Phosphorylation
S102 Phosphorylation
Y103 Phosphorylation
Y106 Phosphorylation
K111 Acetylation
K111 Ubiquitination
K112 Acetylation
K112 Ubiquitination
K115 Ubiquitination
K123 Ubiquitination
K137 Ubiquitination
K182 Ubiquitination
K194 Ubiquitination
K213 Ubiquitination
K220 Ubiquitination
K221 Ubiquitination
N240 N-Glycosylation
K251 Ubiquitination
K259 Ubiquitination
K266 Ubiquitination
K274 Ubiquitination

Research Backgrounds

Function:

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

The sodium/potassium-transporting ATPase is composed of a catalytic alpha subunit, an auxiliary non-catalytic beta subunit and an additional regulatory subunit.

Family&Domains:

The C-terminal lobe folds into an immunoglobulin-like domain and may mediate cell adhesion properties.

Belongs to the X(+)/potassium ATPases subunit beta family.

Research Fields

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Organismal Systems > Circulatory system > Cardiac muscle contraction.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone synthesis.

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.

· Organismal Systems > Excretory system > Proximal tubule bicarbonate reclamation.

· Organismal Systems > Digestive system > Salivary secretion.

· Organismal Systems > Digestive system > Gastric acid secretion.

· Organismal Systems > Digestive system > Pancreatic secretion.

· Organismal Systems > Digestive system > Carbohydrate digestion and absorption.

· Organismal Systems > Digestive system > Protein digestion and absorption.

· Organismal Systems > Digestive system > Mineral absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.