SERPINB9 Antibody - #DF4493
Product: | SERPINB9 Antibody |
Catalog: | DF4493 |
Description: | Rabbit polyclonal antibody to SERPINB9 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 40 KD; 42kD(Calculated). |
Uniprot: | P50453 |
RRID: | AB_2836844 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4493, RRID:AB_2836844.
Fold/Unfold
CAP 3; CAP-3; CAP3; Cytoplasmic antiproteinase 3; Peptidase inhibitor 9; PI-9; PI9; Protease inhibitor 9; Protease inhibitor 9 (ovalbumin type); Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 9; Serpin B9; Serpin peptidase inhibitor clade B (ovalbumin) member 9; Serpin peptidase inhibitor clade B member 9; SERPINB9; SPB9_HUMAN;
Immunogens
- P50453 SPB9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
PTMs - P50453 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T3 | Phosphorylation | Uniprot | |
S72 | Phosphorylation | Uniprot | |
K96 | Acetylation | Uniprot | |
K96 | Ubiquitination | Uniprot | |
S102 | Phosphorylation | Uniprot | |
K117 | Acetylation | Uniprot | |
K138 | Acetylation | Uniprot | |
K138 | Ubiquitination | Uniprot | |
Y166 | Phosphorylation | Uniprot | |
K170 | Ubiquitination | Uniprot | |
K297 | Ubiquitination | Uniprot | |
C310 | S-Nitrosylation | Uniprot | |
K313 | Ubiquitination | Uniprot | |
C350 | S-Nitrosylation | Uniprot | |
S366 | Phosphorylation | Uniprot |
Research Backgrounds
Granzyme B inhibitor.
Cytoplasm.
Belongs to the serpin family. Ov-serpin subfamily.
Research Fields
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.