SFRP2 Antibody - #DF4451
Product: | SFRP2 Antibody |
Catalog: | DF4451 |
Description: | Rabbit polyclonal antibody to SFRP2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 30 KD; 33kD(Calculated). |
Uniprot: | Q96HF1 |
RRID: | AB_2836806 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4451, RRID:AB_2836806.
Fold/Unfold
AI851596; Frizzled related protein 2; FRP 2; FRP-2; FRP2; MGC128911; MGC153618; MGC53344; SARP 1; SARP-1; SARP1; SDF 5; SDF5; Secreted apoptosis related protein 1; Secreted apoptosis-related protein 1; Secreted frizzled related protein 2; Secreted frizzled-related protein 2; sFRP 2; sFRP-2; SFRP2; Sfrp2 protein; SFRP2_HUMAN;
Immunogens
Expressed in adipose tissue, heart, brain, skeletal muscle, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in adipose tissue, small intestine and colon.
- Q96HF1 SFRP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96HF1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T220 | Phosphorylation | Uniprot | |
Y222 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot | |
S289 | Phosphorylation | Uniprot |
Research Backgrounds
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.
Secreted.
Expressed in adipose tissue, heart, brain, skeletal muscle, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in adipose tissue, small intestine and colon.
The FZ domain is involved in binding with Wnt ligands.
Belongs to the secreted frizzled-related protein (sFRP) family.
Research Fields
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
References
Application: WB Species: Human Sample: 293T cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.