RNUXA Antibody - #DF4446
| Product: | RNUXA Antibody |
| Catalog: | DF4446 |
| Description: | Rabbit polyclonal antibody to RNUXA |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 48 KD; 44kD(Calculated). |
| Uniprot: | Q9H814 |
| RRID: | AB_2836801 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4446, RRID:AB_2836801.
Fold/Unfold
FLJ13193; PHAX; PHAX_HUMAN; Phosphorylated adapter RNA export protein; Phosphorylated adaptor for RNA export; RNA U small nuclear RNA export adapter protein; RNA U, small nuclear RNA export adapter (phosphorylation regulated); RNUXA;
Immunogens
- Q9H814 PHAX_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H814 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| S14 | Phosphorylation | Uniprot | |
| S16 | Phosphorylation | Uniprot | |
| S18 | Phosphorylation | Uniprot | |
| T21 | Phosphorylation | Uniprot | |
| S39 | Phosphorylation | Uniprot | |
| Y57 | Phosphorylation | Uniprot | |
| S65 | Phosphorylation | Uniprot | |
| S66 | Phosphorylation | Uniprot | |
| S69 | Phosphorylation | Uniprot | |
| S71 | Phosphorylation | Uniprot | |
| S73 | Phosphorylation | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| K105 | Acetylation | Uniprot | |
| K112 | Acetylation | Uniprot | |
| S146 | Phosphorylation | Uniprot | |
| S149 | Phosphorylation | Uniprot | |
| T151 | Phosphorylation | Uniprot | |
| Y152 | Phosphorylation | Uniprot | |
| Y154 | Phosphorylation | Uniprot | |
| S164 | Phosphorylation | Uniprot | |
| K169 | Methylation | Uniprot | |
| Y178 | Phosphorylation | Uniprot | |
| K183 | Acetylation | Uniprot | |
| K184 | Acetylation | Uniprot | |
| S226 | Phosphorylation | Uniprot | |
| T296 | Phosphorylation | Uniprot | |
| Y316 | Phosphorylation | Uniprot | |
| T327 | Phosphorylation | Uniprot | |
| K339 | Ubiquitination | Uniprot | |
| T349 | Phosphorylation | Uniprot | |
| S350 | Phosphorylation | Uniprot | |
| T353 | Phosphorylation | Uniprot | |
| S356 | Phosphorylation | Uniprot | |
| T358 | Phosphorylation | Uniprot | |
| S364 | Phosphorylation | Uniprot | |
| S368 | Phosphorylation | Uniprot | |
| S388 | Phosphorylation | Uniprot |
Research Backgrounds
A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner (By similarity). Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA.
Phosphorylated in the nucleus. Dephosphorylated in the cytoplasm (By similarity).
Nucleus>Nucleoplasm. Nucleus>Cajal body. Cytoplasm.
Note: Located in the nucleoplasm and Cajal bodies. Shuttles between the nucleus and the cytoplasm. Shuttles between the nucleoplasm and Cajal bodies.
Found in a U snRNA export complex with PHAX/RNUXA, NCBP1/CBP80, NCBP2/CBP20, RAN, XPO1 and m7G-capped RNA. Part of a precomplex with PHAX/RNUXA, NCBP1/CBP80, NCBP2/CBP20 and m7G-capped RNA. Interacts with NCBP1/CBP80 (By similarity). Found in a complex with snoRNA. Interacts with NCBP2/CBP20.
Belongs to the PHAX family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.