ARHGDIG Antibody - #DF4424
| Product: | ARHGDIG Antibody |
| Catalog: | DF4424 |
| Description: | Rabbit polyclonal antibody to ARHGDIG |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine |
| Mol.Wt.: | 25 KD; 25kD(Calculated). |
| Uniprot: | Q99819 |
| RRID: | AB_2836779 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4424, RRID:AB_2836779.
Fold/Unfold
Arhgdig; GDIR3_HUMAN; OTTHUMP00000067353; OTTHUMP00000194914; Rho GDI 3; Rho GDI gamma; Rho GDP dissociation inhibitor (GDI) gamma; Rho GDP dissociation inhibitor 3; Rho GDP dissociation inhibitor gamma; Rho GDP-dissociation inhibitor 3; Rho-GDI gamma; RHOGDI 3; RhoGDI gamma; RHOGDI3;
Immunogens
- Q99819 GDIR3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP.
Cytoplasm.
Primarily expressed in pancreas and brain.
Belongs to the Rho GDI family.
Research Fields
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.