RAB5C Antibody - #DF4406
| Product: | RAB5C Antibody |
| Catalog: | DF4406 |
| Description: | Rabbit polyclonal antibody to RAB5C |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus |
| Mol.Wt.: | 30 KD; 23kD(Calculated). |
| Uniprot: | P51148 |
| RRID: | AB_2836761 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4406, RRID:AB_2836761.
Fold/Unfold
L1880; RAB, member of RAS oncogene family like; RAB5C; RAB5C, member of RAS oncogene family; RAB5C, member RAS oncogene family; RAB5C_HUMAN; RAB5CL; RAB5L; RABL; Ras-related protein Rab-5C;
Immunogens
A synthesized peptide derived from human RAB5C, corresponding to a region within the internal amino acids.
- P51148 RAB5C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Protein transport. Probably involved in vesicular traffic (By similarity).
Phosphorylation of Ser-85 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.
Cell membrane>Lipid-anchor>Cytoplasmic side. Early endosome membrane>Lipid-anchor. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.