RAB31 Antibody - #DF4401
| Product: | RAB31 Antibody |
| Catalog: | DF4401 |
| Description: | Rabbit polyclonal antibody to RAB31 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 21 KD; 22kD(Calculated). |
| Uniprot: | Q13636 |
| RRID: | AB_2836756 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4401, RRID:AB_2836756.
Fold/Unfold
Rab 22B; RAB 31; Rab22B; Rab31; RAB31 member RAS oncogene family; RAB31_HUMAN; Ras related protein Rab 31; Ras related protein Rab31; Ras-related protein Rab-22B; Ras-related protein Rab-31;
Immunogens
Highest expression in placenta and brain with lower levels in heart and lung. Not detected in liver, skeletal muscle, kidney or pancreas.
- Q13636 RAB31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13636 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K7 | Ubiquitination | Uniprot | |
| S35 | Phosphorylation | Uniprot | |
| S78 | Phosphorylation | Uniprot | |
| K97 | Ubiquitination | Uniprot | |
| Y136 | Phosphorylation | Uniprot | |
| S139 | Phosphorylation | Uniprot | |
| S163 | Phosphorylation | Uniprot | |
| T179 | Phosphorylation | Uniprot |
Research Backgrounds
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.
Golgi apparatus>trans-Golgi network. Golgi apparatus>trans-Golgi network membrane>Lipid-anchor>Cytoplasmic side. Early endosome. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side.
Note: Rapidly recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211).
Highest expression in placenta and brain with lower levels in heart and lung. Not detected in liver, skeletal muscle, kidney or pancreas.
Interacts with OCRL. Interacts with NGFR (By similarity). Interacts (in GDP-bound form) with RIN3 and GAPVD1, which function as guanine exchange factors (GEF). Interacts (in GTP-bound form) with EEA1. Interacts with EGFR. Interacts (in GTP-bound form) with APPL2; interaction contributes to or enhances recruitment of APPL2 to the phagosomes; interaction enhances Fc-gamma receptor-mediated phagocytosis through PI3K/Akt signaling in macrophages (By similarity).
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.