PPP1R16A Antibody - #DF4344
Product: | PPP1R16A Antibody |
Catalog: | DF4344 |
Description: | Rabbit polyclonal antibody to PPP1R16A |
Application: | WB |
Reactivity: | Human, Rat |
Mol.Wt.: | 60~70kD; 58kD(Calculated). |
Uniprot: | Q96I34 |
RRID: | AB_2836712 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4344, RRID:AB_2836712.
Fold/Unfold
2900084E10Rik; Likley ortholog of mouse myosin phosphatase targeting subunit 3; MGC14333; Myosin phosphatase target subunit 3; Myosin phosphatase targeting subunit 3; Myosin phosphatase-targeting subunit 3; MYPT3; PP16A_HUMAN; PPP1R16A; Protein phosphatase 1 regulatory subunit 16A; Protein phosphatase 1, regulatory (inhibitor) subunit 16A; R75527;
Immunogens
- Q96I34 PP16A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
PTMs - Q96I34 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S18 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
S199 | Phosphorylation | Uniprot | |
S353 | Phosphorylation | Uniprot | |
S418 | Phosphorylation | Uniprot | |
S433 | Phosphorylation | Uniprot | |
Y434 | Phosphorylation | Uniprot | |
S437 | Phosphorylation | Uniprot | |
K451 | Acetylation | Uniprot | |
K460 | Acetylation | Uniprot | |
K460 | Ubiquitination | Uniprot | |
S478 | Phosphorylation | Uniprot | |
T511 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibits protein phosphatase 1 activity toward phosphorylase, myosin light chain and myosin substrates.
Cell membrane>Lipid-anchor.
Binds PP1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.