CDC40 Antibody - #DF4326
Product: | CDC40 Antibody |
Catalog: | DF4326 |
Description: | Rabbit polyclonal antibody to CDC40 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 66 KD; 66kD(Calculated). |
Uniprot: | O60508 |
RRID: | AB_2836694 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4326, RRID:AB_2836694.
Fold/Unfold
Cdc40; Cell division cycle 40; Cell division cycle 40 homolog; EH binding protein 3; EH-binding protein 3; Ehb3; hPRP17; Pre mRNA processing factor 17; Pre mRNA splicing factor 17; Pre-mRNA-processing factor 17; PRP17; PRP17 homolog; PRP17_HUMAN; PRPF17;
Immunogens
- O60508 PRP17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60508 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
Y12 | Phosphorylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
S18 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot | |
S24 | Phosphorylation | Uniprot | |
S27 | Phosphorylation | Uniprot | |
S43 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S46 | Phosphorylation | Uniprot | |
S49 | Phosphorylation | Uniprot | |
S56 | Phosphorylation | Uniprot | |
Y81 | Phosphorylation | Uniprot | |
T84 | Phosphorylation | Uniprot | |
Y85 | Phosphorylation | Uniprot | |
Y114 | Phosphorylation | Uniprot | |
Y135 | Phosphorylation | Uniprot | |
Y137 | Phosphorylation | Uniprot | |
K198 | Ubiquitination | Uniprot | |
K226 | Acetylation | Uniprot | |
K228 | Acetylation | Uniprot | |
K380 | Ubiquitination | Uniprot | |
K387 | Ubiquitination | Uniprot | |
K399 | Acetylation | Uniprot | |
S435 | Phosphorylation | Uniprot |
Research Backgrounds
Required for pre-mRNA splicing as component of the activated spliceosome.
Nucleus. Nucleus speckle.
Component of the pre-catalytic and catalytic spliceosome complexes. Component of the postcatalytic spliceosome P complex.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.