DECR2 Antibody - #DF4278
| Product: | DECR2 Antibody |
| Catalog: | DF4278 |
| Description: | Rabbit polyclonal antibody to DECR2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 36 KD; 31kD(Calculated). |
| Uniprot: | Q9NUI1 |
| RRID: | AB_2836629 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4278, RRID:AB_2836629.
Fold/Unfold
2 4 dienoyl CoA reductase 2; 2 4 dienoyl CoA reductase 2 peroxisomal; 2; 4-dienoyl-CoA reductase 2; 4-dienoyl-CoA reductase; DECR 2; Decr2; DECR2_HUMAN; EC 1.3.1.34; pDCR; Peroxisomal 2 4 dienoyl CoA reductase; Peroxisomal 2; SDR17C1; Short chain dehydrogenase/reductase family 17C member 1;
Immunogens
- Q9NUI1 DECR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NUI1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| K29 | Ubiquitination | Uniprot | |
| S61 | Phosphorylation | Uniprot | |
| T67 | Phosphorylation | Uniprot | |
| K151 | Acetylation | Uniprot | |
| S226 | Phosphorylation | Uniprot | |
| T232 | Phosphorylation | Uniprot | |
| S234 | Phosphorylation | Uniprot | |
| S287 | Phosphorylation | Uniprot | |
| S289 | Phosphorylation | Uniprot | |
| K291 | Acetylation | Uniprot |
Research Backgrounds
Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
Peroxisome.
Monomer, dimer and oligomer.
Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.