NRBF2 Antibody - #DF4257
Product: | NRBF2 Antibody |
Catalog: | DF4257 |
Description: | Rabbit polyclonal antibody to NRBF2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 36 KD; 32kD(Calculated). |
Uniprot: | Q96F24 |
RRID: | AB_2836608 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4257, RRID:AB_2836608.
Fold/Unfold
Comodulator of PPAR and RXR 1; Comodulator of PPAR and RXR 2; Comodulator of PPAR and RXR; COPR; COPR1; COPR2; DKFZp564C1664; FLJ30395; NRBF 2; NRBF-2; NRBF2; NRBF2_HUMAN; Nuclear receptor binding factor 2; Nuclear receptor-binding factor 2;
Immunogens
Detected in keratinocytes, liver and placenta (PubMed:15610520). Expressed in a subset of cells in pediatric medulloblastoma (PubMed:18619852).
- Q96F24 NRBF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96F24 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K85 | Acetylation | Uniprot | |
K103 | Acetylation | Uniprot | |
S113 | Phosphorylation | Uniprot | |
S116 | Phosphorylation | Uniprot | |
K118 | Ubiquitination | Uniprot | |
S120 | Phosphorylation | Uniprot | |
Y143 | Phosphorylation | Uniprot | |
K148 | Ubiquitination | Uniprot | |
S149 | Phosphorylation | Uniprot | |
S268 | Phosphorylation | Uniprot | |
S277 | Phosphorylation | Uniprot |
Research Backgrounds
May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).
Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy. Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (By similarity). Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1. May be involved in autophagosome biogenesis. May play a role in neural progenitor cell survival during differentiation (By similarity).
Nucleus. Cytoplasm. Cytoplasmic vesicle. Cytoplasmic vesicle>Autophagosome.
Detected in keratinocytes, liver and placenta. Expressed in a subset of cells in pediatric medulloblastoma.
Interacts with PPARA, PPARD and PPARG. Interacts with RARA, RARG and RXRA in the presence of bound ligand. Interacts with SCOC. Associates with the PI3K complex I (PI3KC3-C1); the direct binding partner in the complex is reported variably as PIK3R4 or ATG14.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.