NDUFS3 Antibody - #DF4210
Product: | NDUFS3 Antibody |
Catalog: | DF4210 |
Description: | Rabbit polyclonal antibody to NDUFS3 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 40 KD; 30kD(Calculated). |
Uniprot: | O75489 |
RRID: | AB_2836561 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4210, RRID:AB_2836561.
Fold/Unfold
CI 30; CI 30KD; CI-30kD; Complex I 30KD; Complex I 30kDa subunit; COMPLEX I, MITOCHONDRIAL RESPIRATORY CHAIN, 30-KD SUBUNIT; Complex I-30kD; mitochondrial; NADH coenzyme Q reductase; NADH dehydrogenase (ubiquinone) Fe S protein 3 30kDa; NADH dehydrogenase [ubiquinone] iron sulfur protein 3 mitochondrial; NADH dehydrogenase [ubiquinone] iron-sulfur protein 3; NADH dehydrogenase ubiquinone 30 kDa subunit; NADH-ubiquinone oxidoreductase 30 kDa subunit; NADH-Ubiquinone Oxidoreductase Fe-S Protein 3; NDUFS3; NDUS3_HUMAN;
Immunogens
- O75489 NDUS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75489 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S38 | Phosphorylation | Uniprot | |
T46 | Phosphorylation | Uniprot | |
K56 | Acetylation | Uniprot | |
K56 | Ubiquitination | Uniprot | |
S59 | Phosphorylation | Uniprot | |
Y64 | Phosphorylation | Uniprot | |
T115 | Phosphorylation | Uniprot | |
T121 | Phosphorylation | Uniprot | |
K144 | Ubiquitination | Uniprot | |
T151 | Phosphorylation | Uniprot | |
T189 | Phosphorylation | Uniprot | |
Y191 | Phosphorylation | Uniprot | |
K200 | Ubiquitination | Uniprot | |
Y207 | Phosphorylation | Uniprot | |
K232 | Ubiquitination | Uniprot | |
S237 | Phosphorylation | Uniprot | |
S251 | Phosphorylation | Uniprot | |
K253 | Ubiquitination | Uniprot | |
K264 | Acetylation | Uniprot |
Research Backgrounds
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Mitochondrion inner membrane.
Mammalian complex I is composed of 45 different subunits. Interacts with NDUFAF3. Interacts with RAB5IF.
Belongs to the complex I 30 kDa subunit family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.