MLF1 Antibody - #DF4192
Product: | MLF1 Antibody |
Catalog: | DF4192 |
Description: | Rabbit polyclonal antibody to MLF1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 30 KD; 31kD(Calculated). |
Uniprot: | P58340 |
RRID: | AB_2836557 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4192, RRID:AB_2836557.
Fold/Unfold
Hls7; MLF1; MLF1_HUMAN; Myelodysplasia myeloid leukemia factor 1; Myelodysplasia-myeloid leukemia factor 1; Myeloid leukemia factor 1; myeloid leukemia factor 1 variant 1; myeloid leukemia factor 1 variant 2; myeloid leukemia factor 1 variant 3;
Immunogens
Most abundant in testis, ovary, skeletal muscle, heart, kidney and colon. Low expression in spleen, thymus and peripheral blood leukocytes.
- P58340 MLF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P58340 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S8 | Phosphorylation | Uniprot | |
R23 | Methylation | Uniprot | |
R27 | Methylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
R48 | Methylation | Uniprot | |
R50 | Methylation | Uniprot | |
Y85 | Phosphorylation | Uniprot | |
K88 | Ubiquitination | Uniprot | |
T112 | Phosphorylation | Uniprot | |
Y113 | Phosphorylation | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K168 | Acetylation | Uniprot | |
K169 | Acetylation | Uniprot | |
K174 | Ubiquitination | Uniprot | |
Y206 | Phosphorylation | Uniprot | |
R219 | Methylation | Uniprot | |
S220 | Phosphorylation | Uniprot | |
K236 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
Phosphorylation is required for binding to YWHAZ.
Cytoplasm. Nucleus. Cell projection>Cilium. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Shuttles between the cytoplasm and nucleus.
Most abundant in testis, ovary, skeletal muscle, heart, kidney and colon. Low expression in spleen, thymus and peripheral blood leukocytes.
Interacts with CENPU. Also interacts with NRBP1/MADM, YWHAZ/14-3-3-zeta and HNRPUL2/MANP. NRBP1 recruits a serine kinase which phosphorylates both itself and MLF1. Phosphorylated MLF1 then binds to YWHAZ and is retained in the cytoplasm. Retained in the nucleus by binding to HNRPUL2. Binds to COPS3/CSN3 which is required for suppression of COP1 and activation of p53.
Belongs to the MLF family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.