CLNS1A Antibody - #DF4160
Product: | CLNS1A Antibody |
Catalog: | DF4160 |
Description: | Rabbit polyclonal antibody to CLNS1A |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 37 KD; 26kD(Calculated). |
Uniprot: | P54105 |
RRID: | AB_2836525 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4160, RRID:AB_2836525.
Fold/Unfold
Chloride channel; Chloride channel nucleotide sensitive 1A; Chloride channel regulatory protein; Chloride conductance regulator, volume sensitive; Chloride conductance regulatory protein ICln; Chloride ion current inducer protein; ClCI; CLNS 1A; Clns1a; CLNS1B; I(Cln); ICln; ICLN_HUMAN; Methylosome subunit pICln; nucleotide sensitive 1A; Reticulocyte pICln; Reticulocyte protein ICln;
Immunogens
- P54105 ICLN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P54105 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
K5 | Ubiquitination | Uniprot | |
S6 | Phosphorylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
R43 | Methylation | Uniprot | |
S50 | Phosphorylation | Uniprot | |
K91 | Ubiquitination | Uniprot | |
S102 | Phosphorylation | Uniprot | |
S144 | Phosphorylation | Uniprot | |
Y147 | Phosphorylation | Uniprot | |
Y152 | Phosphorylation | Uniprot | |
Y168 | Phosphorylation | Uniprot | |
Y170 | Phosphorylation | Uniprot | |
S175 | Phosphorylation | Uniprot | |
S193 | Phosphorylation | Uniprot | |
S195 | Phosphorylation | Uniprot | |
S197 | Phosphorylation | Uniprot | |
S198 | Phosphorylation | Uniprot | |
Y200 | Phosphorylation | Uniprot | |
T207 | Phosphorylation | Uniprot | |
S210 | Phosphorylation | Uniprot | |
R212 | Methylation | Uniprot | |
Y214 | Phosphorylation | Uniprot | |
T223 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in both the assembly of spliceosomal snRNPs and the methylation of Sm proteins. Chaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. May also indirectly participate in cellular volume control by activation of a swelling-induced chloride conductance pathway.
Cytoplasm>Cytosol. Nucleus. Cytoplasm>Cytoskeleton.
Note: A small fraction is also associated with the cytoskeleton (PubMed:18984161).
Component of the methylosome, a 20S complex containing at least PRMT5/SKB1, WDR77/MEP50 and CLNS1A/pICln. May mediate SNRPD1 and SNRPD3 methylation. Forms a 6S pICln-Sm complex composed of CLNS1A/pICln, SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG; ring-like structure where CLNS1A/pICln mimics additional Sm proteins and which is unable to assemble into the core snRNP. Interacts with LSM10 and LSM11.
Belongs to the pICln (TC 1.A.47) family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.