MBL2 Antibody - #DF4152
| Product: | MBL2 Antibody |
| Catalog: | DF4152 |
| Description: | Rabbit polyclonal antibody to MBL2 |
| Application: | WB IF/ICC |
| Cited expt.: | WB, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 27 KD; 26kD(Calculated). |
| Uniprot: | P11226 |
| RRID: | AB_2836517 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4152, RRID:AB_2836517.
Fold/Unfold
COLEC 1; COLEC1; Collectin-1; HSMBPC; Lectin, mannose-binding, soluble, 2; Mannan binding lectin; Mannan binding protein; Mannan-binding protein; Mannose binding lectin (protein C) 2 soluble; Mannose binding lectin (protein C) 2, soluble (opsonic defect); Mannose binding lectin (protein C) 2, soluble; Mannose binding lectin 2 soluble; Mannose binding lectin 2, soluble (opsonic defect); Mannose binding lectin; Mannose binding lectin protein C2 soluble opsonic defect; Mannose binding protein; Mannose binding protein C; Mannose binding protein C precursor; Mannose binding protein, serum; Mannose-binding lectin; Mannose-binding protein C; MBL 2; MBL; MBL2; MBL2_HUMAN; MBL2D; MBP 1; MBP; MBP C; MBP-C; MBP1; MBPB; MBPC; MBPD; MGC116832; MGC116833; Opsonic defect; protein C; Soluble mannose binding lectin;
Immunogens
A synthesized peptide derived from human MBL2, corresponding to a region within N-terminal amino acids.
- P11226 MBL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
Secreted.
Plasma protein produced mainly in the liver.
The coiled-coil domain mediates trimerization.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
References
Application: WB Species: human Sample: Huh7 and BEL-7404 cell
Application: IF/ICC Species: human Sample: Huh7 and BEL-7404 cell
Application: IHC Species: human Sample: Huh7 and BEL-7404 cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.