LFA3 Antibody - #DF4147
Product: | LFA3 Antibody |
Catalog: | DF4147 |
Description: | Rabbit polyclonal antibody to LFA3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 28 KD; 28kD(Calculated). |
Uniprot: | P19256 |
RRID: | AB_2836512 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4147, RRID:AB_2836512.
Fold/Unfold
AG3; CD58; CD58 antigen (lymphocyte function associated antigen 3)1; CD58 antigen; CD58 antigen, (lymphocyte function associated antigen 3); CD58 molecule; FLJ23181; FLJ43722; LFA 3; LFA-3; LFA3; LFA3_HUMAN; Lymphocyte Function Associated Antigen Type 3; Lymphocyte function-associated antigen 3; Surface glycoprotein LFA 3; Surface glycoprotein LFA-3;
Immunogens
- P19256 LFA3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
PTMs - P19256 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K62 | Ubiquitination | Uniprot | |
K78 | Ubiquitination | Uniprot | |
S209 | Phosphorylation | Uniprot |
Research Backgrounds
Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
Cell membrane>Single-pass type I membrane protein.
Interacts with CD2. Interacts with CMTM6.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.