AASDHPPT Antibody - #DF4134
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4134, RRID:AB_2836499.
Fold/Unfold
4' phosphopantetheinyl transferase; 4'-phosphopantetheinyl transferase; AASD PPT; AASD-PPT; AASDHPPT; ADPPT_HUMAN; Alpha aminoadipic semialdehyde dehydrogenase phosphopantetheinyl transferase; Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase; CGI 80; HAH P; L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS2; LYS5; LYS5 ortholog;
Immunogens
Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.
- Q9NRN7 ADPPT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NRN7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K45 | Ubiquitination | Uniprot | |
| K58 | Acetylation | Uniprot | |
| K58 | Ubiquitination | Uniprot | |
| K74 | Ubiquitination | Uniprot | |
| K89 | Acetylation | Uniprot | |
| K89 | Ubiquitination | Uniprot | |
| K149 | Acetylation | Uniprot | |
| K149 | Ubiquitination | Uniprot | |
| K151 | Acetylation | Uniprot | |
| K151 | Ubiquitination | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| R161 | Methylation | Uniprot | |
| K164 | Ubiquitination | Uniprot | |
| T168 | Phosphorylation | Uniprot | |
| Y174 | Phosphorylation | Uniprot | |
| K180 | Ubiquitination | Uniprot | |
| K214 | Ubiquitination | Uniprot | |
| K226 | Ubiquitination | Uniprot | |
| S233 | Phosphorylation | Uniprot | |
| S258 | Phosphorylation | Uniprot | |
| K263 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN.
Cytoplasm.
Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.
Monomer. Interacts with FASN.
Belongs to the P-Pant transferase superfamily. AcpS family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Pantothenate and CoA biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.