GDF7 Antibody - #DF4097
Product: | GDF7 Antibody |
Catalog: | DF4097 |
Description: | Rabbit polyclonal antibody to GDF7 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Rabbit |
Mol.Wt.: | 47 KD; 47kD(Calculated). |
Uniprot: | Q7Z4P5 |
RRID: | AB_2836471 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4097, RRID:AB_2836471.
Fold/Unfold
bmp12; bone morphogenetic protein 12; GDF-7; Gdf7; GDF7_HUMAN; growth differentiation factor 7; Growth/differentiation factor 7;
Immunogens
- Q7Z4P5 GDF7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAAAVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADTITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLLLLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7Z4P5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S85 | Phosphorylation | Uniprot | |
Y96 | Phosphorylation | Uniprot | |
S98 | Phosphorylation | Uniprot | |
S146 | Phosphorylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
S243 | Phosphorylation | Uniprot |
Research Backgrounds
May play an active role in the motor area of the primate neocortex.
Secreted.
Homodimer; disulfide-linked.
Belongs to the TGF-beta family.
Research Fields
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Organismal Systems > Development > Axon guidance. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.