TSTA3 Antibody - #DF4085
| Product: | TSTA3 Antibody |
| Catalog: | DF4085 |
| Description: | Rabbit polyclonal antibody to TSTA3 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken |
| Mol.Wt.: | 40 KD, 70 kDa(Observed); 36kD(Calculated). |
| Uniprot: | Q13630 |
| RRID: | AB_2836459 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4085, RRID:AB_2836459.
Fold/Unfold
3 5 epimerase/4 reductase; 5-epimerase-4-reductase; anti TSTA3; EC 1.1.1.271; FCL_HUMAN; FX; GDP 4 keto 6 deoxy D mannose 3 5 epimerase 4 reductase; GDP 4 keto 6 deoxy D mannose epimerase reductase; GDP L fucose synthase; GDP-4-keto-6-deoxy-D-mannose-3; GDP-L-fucose synthase; P35B; Protein FX; Red cell NADP(H) binding protein; Red cell NADP(H)-binding protein; SDR4E1; Short chain dehydrogenase/reductase family 4E member 1; Short-chain dehydrogenase/reductase family 4E member 1; Tissue specific transplantation antigen 3; Tissue specific transplantation antigen P35B; TSTA3; TSTA3 antibody;
Immunogens
A synthesized peptide derived from human TSTA3, corresponding to a region within the internal amino acids.
- Q13630 FCL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.
Belongs to the NAD(P)-dependent epimerase/dehydratase family. Fucose synthase subfamily.
Research Fields
· Metabolism > Carbohydrate metabolism > Fructose and mannose metabolism.
· Metabolism > Carbohydrate metabolism > Amino sugar and nucleotide sugar metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.