POFUT1 Antibody - #DF4084
| Product: | POFUT1 Antibody |
| Catalog: | DF4084 |
| Description: | Rabbit polyclonal antibody to POFUT1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 44 KD; 44kD(Calculated). |
| Uniprot: | Q9H488 |
| RRID: | AB_2836458 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4084, RRID:AB_2836458.
Fold/Unfold
FUT 12; FUT12; GDP fucose protein O fucosyltransferase 1; GDP-fucose protein O-fucosyltransferase 1; O Fuc T; o fucosyltransferase protein; O FucT 1; O FucT; O FucT1; O FUT; O-FucT-1; OFUT 1; OFUT; OFUT1; OFUT1_HUMAN; Peptide O fucosyltransferase1; Peptide-O-fucosyltransferase 1; Pofut 1; POFUT1; Protein O fucosyltransferase1;
Immunogens
Highly expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
- Q9H488 OFUT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H488 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| N62 | N-Glycosylation | Uniprot | |
| Y87 | Phosphorylation | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| N160 | N-Glycosylation | Uniprot | |
| Y211 | Phosphorylation | Uniprot | |
| K246 | Ubiquitination | Uniprot | |
| K295 | Ubiquitination | Uniprot | |
| T310 | Phosphorylation | Uniprot | |
| K324 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue found in the consensus sequence C2-X(4,5)-[S/T]-C3 of EGF domains, where C2 and C3 are the second and third conserved cysteines. Specifically uses GDP-fucose as donor substrate and proper disulfide pairing of the substrate EGF domains is required for fucose transfer. Plays a crucial role in NOTCH signaling. Initial fucosylation of NOTCH by POFUT1 generates a substrate for FRINGE/RFNG, an acetylglucosaminyltransferase that can then extend the fucosylation on the NOTCH EGF repeats. This extended fucosylation is required for optimal ligand binding and canonical NOTCH signaling induced by DLL1 or JAGGED1. Fucosylates AGRN and determines its ability to cluster acetylcholine receptors (AChRs).
N-glycosylated.
Endoplasmic reticulum.
Highly expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Belongs to the glycosyltransferase 65 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Other types of O-glycan biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.