KCNJ9 Antibody - #DF4066
Product: | KCNJ9 Antibody |
Catalog: | DF4066 |
Description: | Rabbit polyclonal antibody to KCNJ9 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Sheep, Dog |
Mol.Wt.: | 44 KD; 44kD(Calculated). |
Uniprot: | Q92806 |
RRID: | AB_2836440 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4066, RRID:AB_2836440.
Fold/Unfold
G protein activated inward rectifier potassium channel 3; G protein coupled inward rectifier potassium channel; G protein-activated inward rectifier potassium channel 3; GIRK-3; GIRK3; Inward rectifier K(+) channel Kir3.3; Inwardly rectifier K(+) channel Kir3.3; Inwardly rectifier K+ channel KIR3.3; inwardly rectifying subfamily J member 9; IRK9_HUMAN; Kcnj9; KIR3.3; Potassium channel; Potassium channel inwardly rectifying subfamily J member 9; Potassium inwardly rectifying channel subfamily J member 9; Potassium inwardly rectifying channel subfamily J9;
Immunogens
- Q92806 KCNJ9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92806 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K27 | Ubiquitination | Uniprot |
Research Backgrounds
This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium (By similarity).
Membrane>Multi-pass membrane protein.
Associates with GIRK1 to form a G-protein-activated heteromultimer pore-forming unit. Interacts (via PDZ-binding motif) with SNX27 (via PDZ domain); the interaction is required when endocytosed to prevent degradation in lysosomes and promote recycling to the plasma membrane (By similarity).
The PDZ-binding motif specifically binds the PDZ domain of SNX27: the specificity for SNX27 is provided by the 2 residues located upstream (Glu-388 and Ser-389) of the PDZ-binding motif.
Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ9 subfamily.
Research Fields
· Human Diseases > Substance dependence > Morphine addiction.
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Endocrine system > Estrogen signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.