Product: FOLR1 Antibody
Catalog: DF4058
Description: Rabbit polyclonal antibody to FOLR1
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 34 KD; 30kD(Calculated).
Uniprot: P15328
RRID: AB_2836432

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(80%), Bovine(80%), Horse(90%), Sheep(80%), Rabbit(90%), Dog(80%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
FOLR1 Antibody detects endogenous levels of total FOLR1.
RRID:
AB_2836432
Cite Format: Affinity Biosciences Cat# DF4058, RRID:AB_2836432.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

adult; Adult folate binding protein; Adult folate-binding protein; FBP; Folate Receptor 1 Adult; Folate receptor 1; Folate Receptor 1 Precursor; Folate receptor adult; Folate receptor alpha; Folate receptor; FOLR; FOLR1; FOLR1_HUMAN; FR alpha; FR-alpha; FRalpha; KB cells FBP; MOV18; Ovarian cancer associated antigen; Ovarian tumor associated antigen; Ovarian tumor associated antigen MOv18; Ovarian tumor-associated antigen MOv18;

Immunogens

Immunogen:

A synthesized peptide derived from human FOLR1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P15328 FOLR1_HUMAN:

Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium.

Sequence:
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Xenopus
100
Horse
90
Rabbit
90
Pig
80
Bovine
80
Sheep
80
Dog
80
Chicken
78
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.

PTMs:

The secreted form is derived from the membrane-bound form either by cleavage of the GPI anchor, or/and by proteolysis catalyzed by a metalloprotease.

Subcellular Location:

Cell membrane>Lipid-anchor. Secreted. Cytoplasmic vesicle. Cytoplasmic vesicle>Clathrin-coated vesicle. Endosome. Apical cell membrane.
Note: Endocytosed into cytoplasmic vesicles and then recycled to the cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium.

Family&Domains:

Belongs to the folate receptor family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

References

1). Tumor Acidity and Near-Infrared Light Responsive Dual Drug Delivery Polydopamine-Based Nanoparticles for Chemo-Photothermal Therapy. Advanced Functional Materials, 2021 [IF=18.5]

2). Reactive oxygen species-responsive dexamethasone-loaded nanoparticles for targeted treatment of rheumatoid arthritis via suppressing the iRhom2/TNF-α/BAFF signaling pathway. Biomaterials, 2020 (PubMed: 31918224) [IF=12.8]

Application: WB    Species: Mouse    Sample: Raw264.7 and MH7A cells

Fig. 3. In vitro cellular uptake of Cy5-labeled NPs. (A) Raw264.7 macrophages induced with LPS (1 μg/mL) for 6 h. Then cellular uptake of Cy5-labeled Dex/Oxi- αCD NPs or Dex/FA-Oxi-αCD NPs was assessed using confocal laser scanning microscopy at various times. Nuclei were counterstained with DAPI (blue). Scale bars, 20 μm. (B) Quantitative analysis of the corresponding fluorescence intensity of intracellular NPs (red) in Raw264.7 cells. (C) The mRNA expression of FRα, FRβ, and FRγ in MH7A cells were analyzed by quantitative real-time PCR. Data were presented by the relative amount of mRNA normalized by GAPDH. (D) Western blot analysis of FRα, FRβ and FRγ expression in Raw264.7 and MH7A cells. α-Tubulin was used as a loading control. (E–F) Cellular uptake (E) and corresponding fluorescence intensity (F) of Cy5-labeled Dex/Oxi-NPs or Dex/FA-Oxi-NPs in MH7A cells at various time points. *p < 0.05. (For interpretation of the references to colour in this figure legend, the reader is referred to the Web version of this article.)

3). Docetaxel-loaded pH/ROS dual-responsive nanoparticles with self-supplied ROS for inhibiting metastasis and enhancing immunotherapy of breast cancer. Journal of Nanobiotechnology, 2023 (PubMed: 37608285) [IF=10.2]

Application: WB    Species: Human    Sample: 4T1 cells and MDA-MB-231 cells

Fig. 3 The cellular uptake of 4T1 cells treated with Cy5, Cy5-labeled CA-Oxi-αCD NPs and Cy5-labeled FA-CA-Oxi-αCD NPs for 6 h. (A) CLSM images of uptake of 4T1 cells with or without FR pretreatment. DAPI for nuclei staining (blue), Cy5 labeled NPs (red). Scale bar represents 20 μm. (B) The semi-quantitative analysis of the corresponding Cy5 fluorescence intensity of intracellular NPs (red) in 4T1 cells with or without FR pretreatment. (C) Quantitative analysis of FR expression in 4T1 cells and MDA-MB-231 cells. (D) Western blot analysis for the expression of FR in 4T1 cells and MDA-MB-231 cells. *p 

Application: IF/ICC    Species: Human    Sample: 4T1 cells and MDA-MB-231 cells

Fig. 3 The cellular uptake of 4T1 cells treated with Cy5, Cy5-labeled CA-Oxi-αCD NPs and Cy5-labeled FA-CA-Oxi-αCD NPs for 6 h. (A) CLSM images of uptake of 4T1 cells with or without FR pretreatment. DAPI for nuclei staining (blue), Cy5 labeled NPs (red). Scale bar represents 20 μm. (B) The semi-quantitative analysis of the corresponding Cy5 fluorescence intensity of intracellular NPs (red) in 4T1 cells with or without FR pretreatment. (C) Quantitative analysis of FR expression in 4T1 cells and MDA-MB-231 cells. (D) Western blot analysis for the expression of FR in 4T1 cells and MDA-MB-231 cells. *p 

4). Folic acid-modified ROS-responsive nanoparticles encapsulating luteolin for targeted breast cancer treatment. Drug Delivery, 2021 (PubMed: 34402706) [IF=6.5]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.