HSD17B2 Antibody - #DF4049
| Product: | HSD17B2 Antibody |
| Catalog: | DF4049 |
| Description: | Rabbit polyclonal antibody to HSD17B2 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Xenopus |
| Mol.Wt.: | 43 KD; 43kD(Calculated). |
| Uniprot: | P37059 |
| RRID: | AB_2836423 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4049, RRID:AB_2836423.
Fold/Unfold
17 beta HSD 2; 17-beta-HSD 2; 17-beta-hydroxysteroid dehydrogenase type 2; 20 alpha HSD; 20 alpha hydroxysteroid dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; DHB2_HUMAN; E2DH; EDH17B2; Estradiol 17-beta-dehydrogenase 2; HSD17; Hsd17b2; Hydroxysteroid (17 beta) dehydrogenase 2; Microsomal 17 beta hydroxysteroid dehydrogenase; Microsomal 17-beta-hydroxysteroid dehydrogenase; SDR9C2; Short chain dehydrogenase/reductase family 9C, member 2; Testosterone 17 beta dehydrogenase; Testosterone 17-beta-dehydrogenase;
Immunogens
- P37059 DHB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P37059 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K141 | Acetylation | Uniprot | |
| S251 | Phosphorylation | Uniprot | |
| S259 | Phosphorylation | Uniprot | |
| T267 | Phosphorylation | Uniprot | |
| S273 | Phosphorylation | Uniprot |
Research Backgrounds
Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
Membrane>Single-pass type II membrane protein.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Research Fields
· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Endocrine system > Ovarian steroidogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.