Product: ERD22 Antibody
Catalog: DF4047
Description: Rabbit polyclonal antibody to ERD22
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 24 KD; 24kD(Calculated).
Uniprot: P33947
RRID: AB_2836421

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
ERD22 Antibody detects endogenous levels of total ERD22.
RRID:
AB_2836421
Cite Format: Affinity Biosciences Cat# DF4047, RRID:AB_2836421.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

(Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 2; ELP 1; ELP-1; ELP1; ER lumen protein retaining receptor 2; ERD 2 like protein; ERD2 like protein 1; ERD2-like protein 1; ERD2.2; ERD22_HUMAN; FLJ45532; KDEL (Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; KDEL receptor 2; KDELR 2; kdelr2;

Immunogens

Immunogen:

A synthesized peptide derived from human ERD22, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum. Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Subcellular Location:

Endoplasmic reticulum membrane>Multi-pass membrane protein. Golgi apparatus membrane>Multi-pass membrane protein. Cytoplasmic vesicle>COPI-coated vesicle membrane>Multi-pass membrane protein.
Note: Localized in the Golgi in the absence of bound proteins with the sequence motif K-D-E-L. Trafficks back to the endoplasmic reticulum together with cargo proteins containing the sequence motif K-D-E-L.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Binds the C-terminal sequence motif K-D-E-L in a hydrophilic cavity between the transmembrane domains. This triggers a conformation change that exposes a Lys-rich patch on the cytosolic surface of the protein (By similarity). This patch mediates recycling from the Golgi to the endoplasmic reticulum, probably via COPI vesicles (By similarity).

Belongs to the ERD2 family.

Research Fields

· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.

References

1). KDELR2-KIF20A axis facilitates bladder cancer growth and metastasis by enhancing Golgi-mediated secretion. Biological Procedures Online, 2022 (PubMed: 36096734) [IF=6.4]

Application: WB    Species: Human    Sample: BCa cells

Fig. 2 KDELR2 functions as an oncogene in BCa. A-B Verification of KDELR2 expression in clinical tissues by qRT-PCR (normal, n = 24; tumor, n = 24) and immunohistochemical (IHC) staining (200x, 400x). C Detection of KDELR2 expression by western blot analysis in cell lines (n = 3). D, G Identification of knockdown or overexpression efficiency of KDELR2 by qRT-PCR and western blot analysis (n = 3). E, H Proliferation analysis of UMUC3 or T24 cells in the control (con) and siKDELR2-3 or KDELR2-overexpressing (ov) group (n = 4). (F, I) Migration and invasion (200x) of BCa cells in the control and siKDELR2-3 or KDELR2-overexpressing group (n = 3).

2). KDELR2 is necessary for chronic obstructive pulmonary disease airway Mucin5AC hypersecretion via an IRE1α/XBP-1s-dependent mechanism. Journal of cellular and molecular medicine, 2024 (PubMed: 39365189) [IF=5.3]

Application: IF/ICC    Species: human    Sample: lung tissues

FIGURE 1 MUC5AC and KDELR2 expression levels are increased in patients with COPD. (A) Genes upregulated in healthy individuals (n = 40) and COPD patients (n = 111) from the GSE76925 dataset. (B) Relative KDELR1, KDELR2, and KDELR3 mRNA levels in healthy controls and patients with COPD in the GSE76925 dataset. (C) Haematoxylin and eosin images, AB-PAS and immunohistochemistry (IHC) analysis of MUC5AC in lung sections from the control group (n = 19) and COPD group (n = 18). The image parameters were as follows: 1600 × 1200, 72 pixels per inch (PPI). (D) The percentage of goblet cells in the lung field was determined. (E) Quantitative immunohistochemistry (IHC) analysis of MUC5AC in COPD patients (n = 18) and control subjects (n = 19). (F) Coimmunofluorescence staining of MUC5AC and KDELR2 in the lung tissues of controls and patients with COPD (2048 × 2048, 96 PPI). Scale bars: 50 μm. IOD: Integrated optical density. Data are shown as the mean ± SEM. *p 

Application: WB    Species: Rat    Sample: lung tissues

FIGURE 5 The IRE1α/XBP-1 s pathway influences KDELR2 expression during MUC5AC overproduction in the airway. (A) Schematic diagram of pharmacological inhibition in rats. (B) The expression of IRE1α, p-IRE1α, XBP-1 s and KDELR2 in the lungs of the control group, COPD group, COPD group treated with DMSO and p-IRE1α inhibitor 4μ8C determined by Western blotting (n = 6). (C–E) Relative protein expression of p-IRE1α/IRE1α, XBP-1 s and KDELR2 measured by Western blotting (n = 6). (F) The relative expression of MUC5AC in BALF was determined by ELISA (n = 6). (G) Relative mRNA expression of MUC5AC in lung tissues measured by RT–qPCR (n = 6). Data are shown as the mean ± SEM; *p 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.