RNF14 Antibody - #DF4026
| Product: | RNF14 Antibody |
| Catalog: | DF4026 |
| Description: | Rabbit polyclonal antibody to RNF14 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 50 KD; 54kD(Calculated). |
| Uniprot: | Q9UBS8 |
| RRID: | AB_2836386 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4026, RRID:AB_2836386.
Fold/Unfold
Androgen receptor associated protein 54; Androgen receptor-associated protein 54; ARA 54; ARA54; E3 ubiquitin protein ligase RNF14; E3 ubiquitin-protein ligase RNF14; FLJ26004; HFB 30; HFB30; HRIHFB2038; RING finger protein 14; RNF 14; Rnf14; RNF14_HUMAN; TRIAD 2; TRIAD2; Triad2 protein;
Immunogens
- Q9UBS8 RNF14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UBS8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K27 | Ubiquitination | Uniprot | |
| S162 | Phosphorylation | Uniprot | |
| T165 | Phosphorylation | Uniprot | |
| S175 | Phosphorylation | Uniprot | |
| S230 | Phosphorylation | Uniprot | |
| Y242 | Phosphorylation | Uniprot | |
| K269 | Ubiquitination | Uniprot | |
| S348 | Phosphorylation | Uniprot | |
| K351 | Ubiquitination | Uniprot | |
| K356 | Ubiquitination | Uniprot | |
| K372 | Ubiquitination | Uniprot | |
| Y379 | Phosphorylation | Uniprot | |
| K386 | Ubiquitination | Uniprot | |
| S393 | Phosphorylation | Uniprot | |
| K394 | Ubiquitination | Uniprot | |
| K399 | Ubiquitination | Uniprot | |
| K402 | Ubiquitination | Uniprot | |
| T409 | Phosphorylation | Uniprot | |
| K444 | Ubiquitination | Uniprot | |
| S451 | Phosphorylation | Uniprot |
Research Backgrounds
Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription.
RING-type zinc finger-dependent and UBE2E2-dependent autoubiquitination.
Cytoplasm. Nucleus.
Widely expressed.
Interacts with the ubiquitin-conjugating enzymes UBE2E1 and UBE2E2. Interacts with AR/androgen receptor; testosterone- and RNF6-regulated it promotes AR transcriptional activity.
The N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.
The RING-type zinc finger is essential for the interaction with UBE2E2.
Members of the RBR family are atypical E3 ligases. They interact with the E2 conjugating enzyme UBE2L3 and function like HECT-type E3 enzymes: they bind E2s via the first RING domain, but require an obligate trans-thiolation step during the ubiquitin transfer, requiring a conserved cysteine residue in the second RING domain.
Belongs to the RBR family. RNF14 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.