RNF125 Antibody - #DF4024
| Product: | RNF125 Antibody |
| Catalog: | DF4024 |
| Description: | Rabbit polyclonal antibody to RNF125 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 26 KD; 26kD(Calculated). |
| Uniprot: | Q96EQ8 |
| RRID: | AB_2836384 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4024, RRID:AB_2836384.
Fold/Unfold
E3 ubiquitin protein ligase RNF125; Ring finger protein 125; RNF 125; T cell RING activation protein 1; T cell ring protein identified in activation screen; TRAC 1;
Immunogens
Predominantly expressed in lymphoid tissues, including bone marrow, spleen and thymus. Also weakly expressed in other tissues. Predominant in the CD4(+) and CD8(+) T-cells, suggesting that it is preferentially confined to T-cells.
- Q96EQ8 RN125_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96EQ8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| G2 | Myristoylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K91 | Ubiquitination | Uniprot | |
| S95 | Phosphorylation | Uniprot | |
| Y97 | Phosphorylation | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| S110 | Phosphorylation | Uniprot | |
| K125 | Ubiquitination | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as DDX58/RIG-I, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53. Acts as a negative regulator of type I interferon production by mediating ubiquitination of DDX58/RIG-I at 'Lys-181', leading to DDX58/RIG-I degradation. Mediates ubiquitination and subsequent degradation of p53/TP53. Mediates ubiquitination and subsequent degradation of JAK1. Acts as a positive regulator of T-cell activation.
Autoubiquitinated, leading to its subsequent proteasomal degradation.
Golgi apparatus membrane>Lipid-anchor.
Note: Shows a reticular staining pattern within the cell and is probably expressed at other intracellular membranes in addition to the Golgi membrane. Not detected at the plasma membrane.
Predominantly expressed in lymphoid tissues, including bone marrow, spleen and thymus. Also weakly expressed in other tissues. Predominant in the CD4(+) and CD8(+) T-cells, suggesting that it is preferentially confined to T-cells.
Interacts with UBE2D1. Interacts with VCP/p97; leading to recruit RNF125 to DDX58/RIG-I and promote ubiquitination of DDX58/RIG-I.
The C2HC RNF-type zinc finger and the linker region stabilize the RING-type zinc finger, leading to promote binding of the RING-type zinc finger to the ubiquitin-conjugating enzyme E2 (donor ubiquitin) (PubMed:27411375).
Research Fields
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.