RPC4 Antibody - #DF4006
| Product: | RPC4 Antibody |
| Catalog: | DF4006 |
| Description: | Rabbit polyclonal antibody to RPC4 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 38 KD; 44kD(Calculated). |
| Uniprot: | P05423 |
| RRID: | AB_2836366 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4006, RRID:AB_2836366.
Fold/Unfold
AI326118; AW489084; BN51 (BHK21) temperature sensitivity complementing; BN51; BN51T; DNA directed RNA polymerase III 47 kDa polypeptide; DNA directed RNA polymerase III subunit D; POLR3D; Polymerase (RNA) III (DNA directed) polypeptide D; Polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; Protein BN51; RNA polymerase III subunit C4; RPC4; RPC53; Temperature sensitive complementation cell cycle specific tsBN51; TSBN51;
Immunogens
- P05423 RPC4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P05423 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S2 | Phosphorylation | Uniprot | |
| R17 | Methylation | Uniprot | |
| T21 | Phosphorylation | Uniprot | |
| R24 | Methylation | Uniprot | |
| R29 | Methylation | Uniprot | |
| R30 | Methylation | Uniprot | |
| T36 | Phosphorylation | Uniprot | |
| S42 | Phosphorylation | Uniprot | |
| T59 | Phosphorylation | Uniprot | |
| K78 | Sumoylation | Uniprot | |
| R90 | Methylation | Uniprot | |
| R95 | Methylation | Uniprot | |
| R97 | Methylation | Uniprot | |
| R99 | Methylation | Uniprot | |
| S105 | Phosphorylation | Uniprot | |
| S107 | Phosphorylation | Uniprot | |
| S130 | Phosphorylation | Uniprot | |
| K141 | Sumoylation | Uniprot | |
| K141 | Ubiquitination | Uniprot | |
| K152 | Ubiquitination | Uniprot | |
| K190 | Sumoylation | Uniprot | |
| K199 | Sumoylation | Uniprot | |
| K199 | Ubiquitination | Uniprot | |
| K206 | Sumoylation | Uniprot | |
| K218 | Ubiquitination | Uniprot | |
| K220 | Sumoylation | Uniprot | |
| K247 | Ubiquitination | Uniprot | |
| S250 | Phosphorylation | Uniprot | |
| K285 | Sumoylation | Uniprot | |
| K285 | Ubiquitination | Uniprot | |
| K288 | Sumoylation | Uniprot | |
| K302 | Sumoylation | Uniprot | |
| K302 | Ubiquitination | Uniprot | |
| K310 | Ubiquitination | Uniprot | |
| K328 | Ubiquitination | Uniprot | |
| K380 | Ubiquitination | Uniprot | |
| K382 | Ubiquitination | Uniprot | |
| S386 | Phosphorylation | Uniprot | |
| K396 | Ubiquitination | Uniprot |
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).
Nucleus.
Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits (By similarity). Interacts with POLR3E/RPC5.
Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.