RPB11 Antibody - #DF4003
Product: | RPB11 Antibody |
Catalog: | DF4003 |
Description: | Rabbit polyclonal antibody to RPB11 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 13 KD; 13kD(Calculated). |
Uniprot: | P52435 |
RRID: | AB_2836363 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4003, RRID:AB_2836363.
Fold/Unfold
DNA directed RNA polymerase II subunit RPB11 a; DNA-directed RNA polymerase II 13.3 kDa polypeptide; DNA-directed RNA polymerase II 13.3 kDa polypeptide; DNA-directed RNA polymerase II subunit J 1; DNA-directed RNA polymerase II subunit J-1; DNA-directed RNA polymerase II subunit RPB11-a; hRPB 14; hRPB14; POLR 2J1; POLR2J; POLR2J1; polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa; polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa; RNA polymerase II 13.3 kDa subunit; RNA polymerase II subunit B11 a; RNA polymerase II subunit B11-a; RPB 11; RPB 11A; RPB 11m; RPB11; RPB11_HUMAN; RPB11a; RPB11m; Rpo2-4;
Immunogens
- P52435 RPB11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52435 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K23 | Ubiquitination | Uniprot | |
K26 | Ubiquitination | Uniprot | |
K37 | Ubiquitination | Uniprot | |
T41 | Phosphorylation | Uniprot | |
K47 | Ubiquitination | Uniprot | |
K52 | Ubiquitination | Uniprot | |
Y61 | Phosphorylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
K70 | Ubiquitination | Uniprot | |
K110 | Ubiquitination | Uniprot |
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft (By similarity).
Nucleus.
Ubiquitously expressed. High expression was found in heart and skeletal muscle.
Component of the RNA polymerase II (Pol II) complex consisting of 12 subunits. Interacts with AATF.
Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.