PRIM1 Antibody - #DF4000
Product: | PRIM1 Antibody |
Catalog: | DF4000 |
Description: | Rabbit polyclonal antibody to PRIM1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Xenopus |
Mol.Wt.: | 50 KD; 50kD(Calculated). |
Uniprot: | P49642 |
RRID: | AB_2836360 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4000, RRID:AB_2836360.
Fold/Unfold
AI324982; DNA primase 49 kDa subunit; DNA primase small subunit; MGC107288; MGC109113; p49; PRI1_HUMAN; PRIM1;
Immunogens
- P49642 PRI1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49642 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T3 | Phosphorylation | Uniprot | |
Y16 | Phosphorylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
K72 | Ubiquitination | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K95 | Ubiquitination | Uniprot | |
K104 | Ubiquitination | Uniprot | |
S123 | Phosphorylation | Uniprot | |
S124 | Phosphorylation | Uniprot | |
K130 | Ubiquitination | Uniprot | |
K147 | Ubiquitination | Uniprot | |
K153 | Ubiquitination | Uniprot | |
S183 | Phosphorylation | Uniprot | |
Y188 | Phosphorylation | Uniprot | |
S190 | Phosphorylation | Uniprot | |
K193 | Ubiquitination | Uniprot | |
K201 | Ubiquitination | Uniprot | |
K207 | Ubiquitination | Uniprot | |
K214 | Ubiquitination | Uniprot | |
S215 | Phosphorylation | Uniprot | |
K221 | Ubiquitination | Uniprot | |
K237 | Ubiquitination | Uniprot | |
K242 | Ubiquitination | Uniprot | |
K261 | Ubiquitination | Uniprot | |
K284 | Ubiquitination | Uniprot | |
S310 | Phosphorylation | Uniprot | |
K311 | Ubiquitination | Uniprot | |
K318 | Ubiquitination | Uniprot | |
S319 | Phosphorylation | Uniprot | |
K326 | Ubiquitination | Uniprot | |
S331 | Phosphorylation | Uniprot | |
S361 | Phosphorylation | Uniprot | |
T362 | Phosphorylation | Uniprot | |
K367 | Ubiquitination | Uniprot | |
K377 | Ubiquitination | Uniprot | |
K385 | Ubiquitination | Uniprot | |
T386 | Phosphorylation | Uniprot | |
S387 | Phosphorylation | Uniprot | |
Y391 | Phosphorylation | Uniprot | |
K404 | Ubiquitination | Uniprot | |
K418 | Ubiquitination | Uniprot |
Research Backgrounds
Catalytic subunit of the DNA primase complex and component of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which play an essential role in the initiation of DNA synthesis. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1, an accessory subunit POLA2 and two primase subunits, the catalytic subunit PRIM1 and the regulatory subunit PRIM2) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1 (By similarity). The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively (By similarity). In the primase complex, both subunits are necessary for the initial di-nucleotide formation, but the extension of the primer depends only on the catalytic subunit. Can add both ribo- and deoxynucleotides during elongation of the primers (By similarity). Binds single stranded DNA (By similarity).
Heterodimer of a catalytic subunit PRIM1 and a regulatory subunit PRIM2, also known as the DNA primase complex. Interacts with PRIM2 (via C-terminus). Component of the alpha DNA polymerase complex (also known as the alpha DNA polymerase-primase complex) consisting of four subunits: the catalytic subunit POLA1, the regulatory subunit POLA2, and the primase complex subunits PRIM1 and PRIM2 respectively. Within the complex, POLA1 directly interacts with PRIM2 (By similarity).
Belongs to the eukaryotic-type primase small subunit family.
Research Fields
· Genetic Information Processing > Replication and repair > DNA replication.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.