DHRS4 Antibody - #DF3986

(1)   (5)  
Product: DHRS4 Antibody
Catalog: DF3986
Description: Rabbit polyclonal antibody to DHRS4
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 32-34 KD; 30kD(Calculated).
Uniprot: Q9BTZ2
RRID: AB_2836346

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
DHRS4 Antibody detects endogenous levels of total DHRS4.
RRID:
AB_2836346
Cite Format: Affinity Biosciences Cat# DF3986, RRID:AB_2836346.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AI043103; AI790593; Carbonyl reductase; CR; D14Ucla2; Dehydrogenase/reductase SDR family member 4; Dhrs4; DHRS4_HUMAN; humNRDR; mouNRDR; NADPH dependent carbonyl reductase/NADP retinol dehydrogenase; NADPH dependent retinol dehydrogenase/reductase; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; NDRD; NRDR; Peroxisomal short chain alcohol dehydrogenase; Peroxisomal short-chain alcohol dehydrogenase; PHCR; PRO1800; PSCD; RRD; SCAD-SRL; SCADSRL; Short chain dehydrogenase/reductase family member 4; Short-chain dehydrogenase/reductase family member 4; UNQ851;

Immunogens

Immunogen:
Uniprot:

Q9BTZ2(DHRS4_HUMAN) >>Visit HPA database.

Gene(ID):
DHRS4(10901)
Expression:
Q9BTZ2 DHRS4_HUMAN:

Isoform 1 is predominantly expressed in normal cervix (at protein level). Isoform 4 is expressed in some neoplastic cervical tissues, but not in normal cervix (at protein level). Isoform 5 and isoform 6 are expressed in a few neoplastic cervical tissues.

Sequence:
MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL

PTMs - Q9BTZ2 As Substrate

Site PTM Type Enzyme
S63 Phosphorylation
K65 Ubiquitination
T149 Phosphorylation
K150 Ubiquitination
K194 Ubiquitination
K216 Ubiquitination
T274 Phosphorylation

Research Backgrounds

Function:

Reduces all-trans-retinal and 9-cis retinal. Can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Reduces alkyl phenyl ketones and alpha-dicarbonyl compounds with aromatic rings, such as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine, menadione and 4-hexanoylpyridine. Has no activity towards aliphatic aldehydes and ketones (By similarity).

Subcellular Location:

Peroxisome.
Note: Isoform 1 is peroxisomal, while isoform 4 is not.

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 is predominantly expressed in normal cervix (at protein level). Isoform 4 is expressed in some neoplastic cervical tissues, but not in normal cervix (at protein level). Isoform 5 and isoform 6 are expressed in a few neoplastic cervical tissues.

Subunit Structure:

Homotetramer.

Family&Domains:

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). Identification of Molecular Correlations Between DHRS4 and Progressive Neurodegeneration in Amyotrophic Lateral Sclerosis By Gene Co-Expression Network Analysis. Frontiers in Immunology, 2022 (PubMed: 35479082) [IF=7.3]

Application: WB    Species: Mice    Sample: immune cells

Figure 4 Validation of Dhrs4 by Western blotting and immunofluorescence. (A–C) Representative Western blotting images of Dhrs4 in SOD1G93A mice compared with WT mice. (A, B) Dhrs4 expression has no significant difference in pre-onset and onset stages, respectively. (C) At progression stage of SOD1G93A mice, the expression of Dhrs4 is markedly upregulated. Data are presented as the mean ± SD (n = 3 or 4 per group), unpaired t-test, ***p < 0.001. (D) The expression of Dhrs4 in neurons is shown. The NeuN and Dhrs4 are double-labeled performed with anti-Dhrs4 (red) and anti-NeuN (green), respectively. (E) Quantifications of Dhrs4 fluorescence intensity per neuron (IOD). Data are presented as the mean ± SD (n = 3 per group), unpaired t-test with Welch’s correction; ***p < 0.001. Scale bars, 20 μm. WT, wild type. IOD, Integral optical density.

Application: IF/ICC    Species: Mice    Sample: immune cells

Figure 4 Validation of Dhrs4 by Western blotting and immunofluorescence. (A–C) Representative Western blotting images of Dhrs4 in SOD1G93A mice compared with WT mice. (A, B) Dhrs4 expression has no significant difference in pre-onset and onset stages, respectively. (C) At progression stage of SOD1G93A mice, the expression of Dhrs4 is markedly upregulated. Data are presented as the mean ± SD (n = 3 or 4 per group), unpaired t-test, ***p < 0.001. (D) The expression of Dhrs4 in neurons is shown. The NeuN and Dhrs4 are double-labeled performed with anti-Dhrs4 (red) and anti-NeuN (green), respectively. (E) Quantifications of Dhrs4 fluorescence intensity per neuron (IOD). Data are presented as the mean ± SD (n = 3 per group), unpaired t-test with Welch’s correction; ***p < 0.001. Scale bars, 20 μm. WT, wild type. IOD, Integral optical density.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.