ELOVL5 Antibody - #DF4038
Product: | ELOVL5 Antibody |
Catalog: | DF4038 |
Description: | Rabbit polyclonal antibody to ELOVL5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 28 KD; 35kD(Calculated). |
Uniprot: | Q9NYP7 |
RRID: | AB_2836331 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4038, RRID:AB_2836331.
Fold/Unfold
3 keto acyl CoA synthase ELOVL5; 3-keto acyl-CoA synthase Elovl5; dJ483K16.1; Elongation of very long chain fatty acids like 5; Elongation of very long chain fatty acids protein 5; ELOV5_HUMAN; ELOVL 5; ELOVL family member 5; ELOVL family member 5 elongation of long chain fatty acids; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); ELOVL fatty acid elongase 5; ELOVL2; elovl5; Fatty acid elongase 1; hELO1; Homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2; OTTHUMP00000017867; RP3 483K16.1; RP3-483K16.1;
Immunogens
Ubiquitous. Highly expressed in the adrenal gland and testis. Weakly expressed in prostate, lung and brain. Expressed in the cerebellum.
- Q9NYP7 ELOV5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NYP7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K13 | Ubiquitination | Uniprot | |
K56 | Ubiquitination | Uniprot | |
K267 | Ubiquitination | Uniprot | |
S273 | Phosphorylation | Uniprot | |
T281 | Phosphorylation | Uniprot | |
S283 | Phosphorylation | Uniprot | |
S285 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators (By similarity). In conditions where the essential linoleic and alpha linoleic fatty acids are lacking it is also involved in the synthesis of Mead acid from oleic acid (By similarity).
Endoplasmic reticulum membrane>Multi-pass membrane protein. Cell projection>Dendrite.
Note: In Purkinje cells, the protein localizes to the soma and proximal portion of the dendritic tree.
Ubiquitous. Highly expressed in the adrenal gland and testis. Weakly expressed in prostate, lung and brain. Expressed in the cerebellum.
Belongs to the ELO family. ELOVL5 subfamily.
Research Fields
· Metabolism > Lipid metabolism > Fatty acid elongation.
· Metabolism > Lipid metabolism > Biosynthesis of unsaturated fatty acids.
· Metabolism > Global and overview maps > Fatty acid metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.