Product: C1QBP Antibody
Catalog: DF3962
Description: Rabbit polyclonal antibody to C1QBP
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus
Mol.Wt.: 32 KD; 31kD(Calculated).
Uniprot: Q07021
RRID: AB_2836315

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Zebrafish(82%), Bovine(91%), Horse(91%), Sheep(91%), Dog(91%), Xenopus(91%)
Clonality:
Polyclonal
Specificity:
C1QBP Antibody detects endogenous levels of total C1QBP.
RRID:
AB_2836315
Cite Format: Affinity Biosciences Cat# DF3962, RRID:AB_2836315.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ASF/SF2 associated protein p32; C1q globular domain binding protein; C1qBP; C1QBP_HUMAN; Complement component 1 q subcomponent binding protein; Complement component 1 Q subcomponent binding protein mitochondrial; Complement component 1 Q subcomponent-binding protein, mitochondrial; GC1Q R; GC1q R protein; GC1q-R protein; GC1QBP; GC1QR; globular domain of, C1q, receptor for; Glycoprotein gC1qBP; HABP 1; HABP1; Hyaluronan binding protein 1; Hyaluronan-binding protein 1; Mitochondrial matrix protein p32; p32; p32 splicing factor; p33; Pre mrna splicing factor SF2 P32 subunit precursor; SF2p32; Splicing factor SF2 associated protein;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q07021 C1QBP_HUMAN:

Expressed on cell surface of peripheral blood cells (at protein level); Surface expression is reported for macrophages and monocyte-derived dendritic cells.

Sequence:
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
91
Horse
91
Bovine
91
Sheep
91
Dog
91
Xenopus
91
Zebrafish
82
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q07021 As Substrate

Site PTM Type Enzyme
K80 Acetylation
K80 Ubiquitination
S87 Phosphorylation
K91 Acetylation
K91 Ubiquitination
K104 Acetylation
K104 Ubiquitination
S150 Phosphorylation Q13315 (ATM)
T163 Phosphorylation
S164 Phosphorylation
T165 Phosphorylation
K174 Ubiquitination
K179 Acetylation
K180 Acetylation
K180 Ubiquitination
Y188 Phosphorylation
S201 Phosphorylation
S205 Phosphorylation
S210 Phosphorylation
S213 Phosphorylation
T214 Phosphorylation
S217 Phosphorylation
K220 Methylation

Research Backgrounds

Function:

Is believed to be a multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, protein synthesis in mitochondria, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing. At the cell surface is thought to act as an endothelial receptor for plasma proteins of the complement and kallikrein-kinin cascades. Putative receptor for C1q; specifically binds to the globular 'heads' of C1q thus inhibiting C1; may perform the receptor function through a complex with C1qR/CD93. In complex with cytokeratin-1/KRT1 is a high affinity receptor for kininogen-1/HMWK. Can also bind other plasma proteins, such as coagulation factor XII leading to its autoactivation. May function to bind initially fluid kininogen-1 to the cell membrane. The secreted form may enhance both extrinsic and intrinsic coagulation pathways. It is postulated that the cell surface form requires docking with transmembrane proteins for downstream signaling which might be specific for a cell-type or response. By acting as C1q receptor is involved in chemotaxis of immature dendritic cells and neutrophils and is proposed to signal through CD209/DC-SIGN on immature dendritic cells, through integrin alpha-4/beta-1 during trophoblast invasion of the decidua, and through integrin beta-1 during endothelial cell adhesion and spreading. Signaling involved in inhibition of innate immune response is implicating the PI3K-AKT/PKB pathway. Required for protein synthesis in mitochondria. In mitochondrial translation may be involved in formation of functional 55S mitoribosomes; the function seems to involve its RNA-binding activity. May be involved in the nucleolar ribosome maturation process; the function may involve the exchange of FBL for RRP1 in the association with pre-ribosome particles. Involved in regulation of RNA splicing by inhibiting the RNA-binding capacity of SRSF1 and its phosphorylation. Is required for the nuclear translocation of splicing factor U2AF1L4. Involved in regulation of CDKN2A- and HRK-mediated apoptosis. Stabilizes mitochondrial CDKN2A isoform smARF. May be involved in regulation of FOXC1 transcriptional activity and NFY/CCAAT-binding factor complex-mediated transcription. May play a role in antibacterial defense as it can bind to cell surface hyaluronan and inhibit Streptococcus pneumoniae hyaluronate lyase. May be involved in modulation of the immune response; ligation by HCV core protein is resulting in suppression of interleukin-12 production in monocyte-derived dendritic cells. Involved in regulation of antiviral response by inhibiting DDX58- and IFIH1-mediated signaling pathways probably involving its association with MAVS after viral infection.

(Microbial infection) Involved in HIV-1 replication, presumably by contributing to splicing of viral RNA.

(Microbial infection) In infection processes acts as an attachment site for microbial proteins, including Listeria monocytogenes internalin B (InlB) and Staphylococcus aureus protein A.

(Microbial infection) Involved in replication of Rubella virus.

Subcellular Location:

Mitochondrion matrix. Nucleus. Cell membrane>Peripheral membrane protein>Extracellular side. Secreted. Cytoplasm. Nucleus>Nucleolus.
Note: Seems to be predominantly localized to mitochondria. Secreted by activated lymphocytes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed on cell surface of peripheral blood cells (at protein level); Surface expression is reported for macrophages and monocyte-derived dendritic cells.

Subunit Structure:

Homotrimer; three monomers form a donut-shaped structure with an unusually asymmetric charge distribution on the surface. Interacts with CDK13, HRK, VTN, NFYB, ADRA1B, FOXC1, DDX21, DDX50, NCL, SRSF1, SRSF9 and CDKN2A isoform smARF. Interacts with CD93; the association may represent a cell surface C1q receptor. Interacts with KRT1; the association represents a cell surface kininogen receptor. Interacts with CD209; the interaction is indicative for a C1q:C1QBP:CD209 signaling complex. Interacts with FBL and RRP1; the respective interactions with C1QBP are competetive. Probably associates with the mitoribosome. Interacts with MAVS; the interaction occurs upon viral transfection. Interacts with PPIF. Interacts with U2AF1L4. Interacts with PLEKHN1. Interacts with VGF-derived peptide TLQP-21 (By similarity).

(Microbial infection) Interacts with Rubella virus capsid protein; the interaction occurs in mitochondria. Interacts with Rubella virus protease/methyltransferase p150.

(Microbial infection) Interacts with Staphylococcus aureus protein A/spa.

(Microbial infection) Interacts with Staphylococcus aureus protein A/spa, HIV-1 Tat and HCV core protein.

(Microbial infection) Interacts with HIV-1 Tat and HCV core protein.

(Microbial infection) Interacts with L.monocytogenes internalin B.

Family&Domains:

Belongs to the MAM33 family.

Research Fields

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

References

1). Antitumor Effect and Immune Response of Nanosecond Pulsed Electric Fields in Pancreatic Cancer. Frontiers in Oncology, 2021 (PubMed: 33634030) [IF=3.5]

Application: IHC    Species: Human    Sample: Pancreatic Cancer

Figure 8 IHC staining of viable tumor region at 3 and 7 days after the initiation of treatment. Representative micrographs of staining for α-SMA, FAP-α, HABP1. Five visual fields were randomly captured for each group. Magnification, 200×.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.