ST6GAL1 Antibody - #DF3950
 (1)  
			
			
			(6)
(1)  
			
			
			(6)  
			
			
		| Product: | ST6GAL1 Antibody | 
| Catalog: | DF3950 | 
| Description: | Rabbit polyclonal antibody to ST6GAL1 | 
| Application: | WB IHC IF/ICC | 
| Cited expt.: | IF/ICC | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken | 
| Mol.Wt.: | 42 KD,55KD(Glycosylation); 47kD(Calculated). | 
| Uniprot: | P15907 | 
| RRID: | AB_2836303 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3950, RRID:AB_2836303.
Fold/Unfold
6 sialyltransferase; 6-sialyltransferase 1; 6-ST 1; Alpha 2; Alpha 2,6 ST 1; Alpha 2,6 ST; B cell antigen CD75; B-cell antigen CD75; Beta galactoside alpha 2,6 sialyltransferase 1; Beta-galactoside alpha-2; CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase 1; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; MGC48859; Sialyltransferase 1 (beta galactoside alpha 2,6 sialyltransferase); Sialyltransferase 1; SIAT1; SIAT1_HUMAN; ST6 beta galactosamide alpha 2,6 sialyltranferase 1; ST6Gal I; ST6GAL1; ST6GalI; ST6N;
Immunogens
A synthesized peptide derived from human ST6GAL1, corresponding to a region within the internal amino acids.
- P15907 SIAT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
The soluble form derives from the membrane form by proteolytic processing.
The HB-6, CDW75, and CD76 differentiation antigens are cell-surface carbohydrate determinants generated by this enzyme.
N-glycosylated.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Secreted. 
Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
Belongs to the glycosyltransferase 29 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > N-Glycan biosynthesis.
· Metabolism > Glycan biosynthesis and metabolism > Other types of O-glycan biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: IF/ICC Species: Human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											 
											 
											 
											 
											