CLN5 Antibody - #DF3927
Product: | CLN5 Antibody |
Catalog: | DF3927 |
Description: | Rabbit polyclonal antibody to CLN5 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 46 KD; 41kD(Calculated). |
Uniprot: | O75503 |
RRID: | AB_2836280 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3927, RRID:AB_2836280.
Fold/Unfold
Ceroid lipofuscinosis neuronal 5; Ceroid-lipofuscinosis neuronal protein 5; CLN5; CLN5_HUMAN; NCL; Protein CLN5;
Immunogens
- O75503 CLN5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75503 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K65 | Ubiquitination | Uniprot | |
K105 | Ubiquitination | Uniprot | |
N130 | N-Glycosylation | Uniprot | |
N143 | N-Glycosylation | Uniprot | |
N178 | N-Glycosylation | Uniprot | |
N203 | N-Glycosylation | Uniprot | |
K215 | Ubiquitination | Uniprot | |
N255 | N-Glycosylation | Uniprot | |
N271 | N-Glycosylation | Uniprot | |
N281 | N-Glycosylation | Uniprot | |
T283 | Phosphorylation | Uniprot | |
N352 | N-Glycosylation | Uniprot |
Research Backgrounds
Plays a role in influencing the retrograde trafficking of lysosomal sorting receptors SORT1 and IGF2R from the endosomes to the trans-Golgi network by controlling the recruitment of retromer complex to the endosomal membrane. Regulates the localization and activation of RAB7A which is required to recruit the retromer complex to the endosomal membrane.
N-glycosylated with both high mannose and complex type sugars. Glycosylation is important for proper folding and trafficking to the lysosomes.
The type II membrane signal anchor is proteolytically cleaved to produce a mature form that is transported to the lysosomes (Ceroid-lipofuscinosis neuronal protein 5, secreted form).
Can undergo proteolytic cleavage at the C-terminus, probably by a cysteine protease and may involve the removal of approximately 10-15 residues from the C-terminal end.
Lysosome.
Membrane>Single-pass type II membrane protein.
Note: An amphipathic anchor region facilitates its association with the membrane.
Ubiquitous.
Interacts with SORT1, RAB5A and RAB7A. Interacts with PPT1, TPP1, CLN3, CLN6, CLN8, ATP5F1A and ATP5F1B (By similarity).
Belongs to the CLN5 family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.