CEP57 Antibody - #DF3919
Product: | CEP57 Antibody |
Catalog: | DF3919 |
Description: | Rabbit polyclonal antibody to CEP57 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Dog |
Mol.Wt.: | 50 KD; 57kD(Calculated). |
Uniprot: | Q86XR8 |
RRID: | AB_2836272 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3919, RRID:AB_2836272.
Fold/Unfold
Centrosomal protein 57kDa; Centrosomal protein of 57 kDa; Cep57; Cep57 protein; CEP57_HUMAN; FGF2 interacting protein; FGF2-interacting protein; KIAA0092; MVA2; PIG8; Proliferation inducing protein 8; Testis specific protein 57; Testis-specific protein 57; Translokin; TSP57;
Immunogens
- Q86XR8 CEP57_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q86XR8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S10 | Phosphorylation | Uniprot | |
S15 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
S33 | Phosphorylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
Y36 | Phosphorylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
S53 | Phosphorylation | Uniprot | |
S55 | Phosphorylation | Uniprot | |
K56 | Ubiquitination | Uniprot | |
T58 | Phosphorylation | Uniprot | |
Y61 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
S66 | Phosphorylation | Uniprot | |
K79 | Ubiquitination | Uniprot | |
K95 | Ubiquitination | Uniprot | |
T96 | Phosphorylation | Uniprot | |
T101 | Phosphorylation | Uniprot | |
Y104 | Phosphorylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K106 | Ubiquitination | Uniprot | |
S118 | Phosphorylation | Uniprot | |
K119 | Ubiquitination | Uniprot | |
K124 | Ubiquitination | Uniprot | |
K139 | Ubiquitination | Uniprot | |
K145 | Ubiquitination | Uniprot | |
K155 | Ubiquitination | Uniprot | |
K167 | Ubiquitination | Uniprot | |
K188 | Ubiquitination | Uniprot | |
K198 | Ubiquitination | Uniprot | |
K208 | Ubiquitination | Uniprot | |
K209 | Ubiquitination | Uniprot | |
K225 | Ubiquitination | Uniprot | |
K230 | Ubiquitination | Uniprot | |
K248 | Ubiquitination | Uniprot | |
T250 | Phosphorylation | Uniprot | |
K265 | Acetylation | Uniprot | |
K265 | Sumoylation | Uniprot | |
K269 | Acetylation | Uniprot | |
K319 | Ubiquitination | Uniprot | |
K334 | Ubiquitination | Uniprot | |
S388 | Phosphorylation | Uniprot | |
T390 | Phosphorylation | Uniprot | |
K394 | Ubiquitination | Uniprot | |
K396 | Ubiquitination | Uniprot | |
K411 | Ubiquitination | Uniprot | |
K417 | Ubiquitination | Uniprot | |
K420 | Ubiquitination | Uniprot | |
K462 | Ubiquitination | Uniprot | |
K473 | Acetylation | Uniprot | |
K476 | Ubiquitination | Uniprot |
Research Backgrounds
Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2, but that of FGF1.
Nucleus. Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Ubiquitous.
Homodimer and homooligomer. Interacts with microtubules. Interacts with FGF2 and RAP80. Does not interact with FGF1 or FGF2 isoform 24 kDa.
The C-terminal region mediates the interaction with microtubules and is able to nucleate and bundles microtubules in vitro.
The centrosome localization domain (CLD) region mediates the localization to centrosomes and homooligomerization.
Belongs to the translokin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.