CA14 Antibody - #DF3888
| Product: | CA14 Antibody |
| Catalog: | DF3888 |
| Description: | Rabbit polyclonal antibody to CA14 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 34 KD; 38kD(Calculated). |
| Uniprot: | Q9ULX7 |
| RRID: | AB_2836241 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3888, RRID:AB_2836241.
Fold/Unfold
CA 14; CA XIV; CA-XIV; CA14; CAH14_HUMAN; Carbonate dehydratase XIV; Carbonic anhydrase 14; Carbonic anhydrase XIV; Carbonic dehydratase; CAXIV; UNQ690/PRO1335;
Immunogens
High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
- Q9ULX7 CAH14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9ULX7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y174 | Phosphorylation | Uniprot | |
| S179 | Phosphorylation | Uniprot | |
| N213 | N-Glycosylation | Uniprot | |
| S234 | Phosphorylation | Uniprot | |
| S237 | Phosphorylation | Uniprot | |
| T286 | Phosphorylation | Uniprot | |
| S325 | Phosphorylation | Uniprot |
Research Backgrounds
Reversible hydration of carbon dioxide.
Membrane>Single-pass type I membrane protein.
High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
Belongs to the alpha-carbonic anhydrase family.
Research Fields
· Metabolism > Energy metabolism > Nitrogen metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.