CHST2 Antibody - #DF3883
Product: | CHST2 Antibody |
Catalog: | DF3883 |
Description: | Rabbit polyclonal antibody to CHST2 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Bovine, Dog |
Mol.Wt.: | 58 KD; 58kD(Calculated). |
Uniprot: | Q9Y4C5 |
RRID: | AB_2836236 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3883, RRID:AB_2836236.
Fold/Unfold
AI428561; AW121776; C130041E03Rik; C6ST; Carbohydrate (chondroitin 6/keratan) sulfotransferase 2; Carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; Carbohydrate sulfotransferase 2; CHST2; CHST2_HUMAN; Chts2; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GlcNAc6ST; GlcNAc6ST-1; Gn6st; Gn6st-1; GST 2; GST-2; GST2; N-acetylglucosamine 6-O-sulfotransferase 1; N-acetylglucosamine 6-O-sulfotransferase;
Immunogens
Widely expressed. Highly expressed in bone marrow, peripheral blood leukocytes, spleen, brain, spinal cord, ovary and placenta. Expressed by high endothelial cells (HEVs) and leukocytes.
- Q9Y4C5 CHST2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTMLNLLDYKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAAAGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y4C5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N243 | N-Glycosylation | Uniprot | |
K269 | Ubiquitination | Uniprot | |
Y425 | Phosphorylation | Uniprot | |
N457 | N-Glycosylation | Uniprot | |
N475 | N-Glycosylation | Uniprot | |
K518 | Ubiquitination | Uniprot |
Research Backgrounds
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as SELL ligands. SELL ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of the SELL ligand sialyl 6-sulfo Lewis X and in lymphocyte homing to Peyer patches. Has no activity toward O-linked sugars. Its substrate specificity may be influenced by its subcellular location. Sulfates GlcNAc residues at terminal, non-reducing ends of oligosaccharide chains.
Glycosylation at Asn-475 is required for catalytic activity.
Golgi apparatus>trans-Golgi network membrane>Single-pass type II membrane protein.
Widely expressed. Highly expressed in bone marrow, peripheral blood leukocytes, spleen, brain, spinal cord, ovary and placenta. Expressed by high endothelial cells (HEVs) and leukocytes.
Homodimer; disulfide-linked. Homodimerization is not essential for enzyme activity.
Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - keratan sulfate.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.