CHST13 Antibody - #DF3882
| Product: | CHST13 Antibody |
| Catalog: | DF3882 |
| Description: | Rabbit polyclonal antibody to CHST13 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Chicken |
| Mol.Wt.: | 39 KD; 39kD(Calculated). |
| Uniprot: | Q8NET6 |
| RRID: | AB_2836235 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3882, RRID:AB_2836235.
Fold/Unfold
C4ST 3; C4ST-3; C4ST3; Carbohydrate (chondroitin 4) sulfotransferase 13; Carbohydrate sulfotransferase 13; Chondroitin 4 O sulfotransferase 3; Chondroitin 4 sulfotransferase 3; Chondroitin 4-O-sulfotransferase 3; Chondroitin 4-sulfotransferase 3; CHST 13; CHST13; CHSTD_HUMAN; MGC119278; MGC119279; MGC119281;
Immunogens
Highly expressed in adult liver. Expressed at lower level in kidney, lymph nodes and fetal kidney.
- Q8NET6 CHSTD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVRFAEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8NET6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S139 | Phosphorylation | Uniprot | |
| Y200 | Phosphorylation | Uniprot | |
| Y337 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. No activity toward dermatan.
Golgi apparatus membrane>Single-pass type II membrane protein.
Highly expressed in adult liver. Expressed at lower level in kidney, lymph nodes and fetal kidney.
Belongs to the sulfotransferase 2 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.