CLIP3 Antibody - #DF3878
Product: | CLIP3 Antibody |
Catalog: | DF3878 |
Description: | Rabbit polyclonal antibody to CLIP3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 60 KD; 60kD(Calculated). |
Uniprot: | Q96DZ5 |
RRID: | AB_2836231 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3878, RRID:AB_2836231.
Fold/Unfold
1500005P14Rik; AI844915; CAP GLY domain containing linker protein 3; CAP-Gly domain-containing linker protein 3; CLIP 170 related 59 kDa protein; CLIP-170-related 59 kDa protein; clip3; CLIP3_HUMAN; CLIPR 59; CLIPR-59; CLIPR59; Cytoplasmic linker protein 170 related 59 kDa protein; Cytoplasmic linker protein 170-related 59 kDa protein; Restin like 1; RSNL1;
Immunogens
- Q96DZ5 CLIP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEILFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASSLCLGAAKCLLEHGANPALRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96DZ5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K127 | Ubiquitination | Uniprot | |
S245 | Phosphorylation | Uniprot | |
K256 | Ubiquitination | Uniprot | |
K306 | Ubiquitination | Uniprot | |
S373 | Phosphorylation | Uniprot | |
T386 | Phosphorylation | Uniprot | |
T399 | Phosphorylation | Uniprot | |
S401 | Phosphorylation | Uniprot | |
S402 | Phosphorylation | Uniprot | |
S404 | Phosphorylation | Uniprot | |
S407 | Phosphorylation | Uniprot | |
K428 | Ubiquitination | Uniprot | |
K456 | Ubiquitination | Uniprot | |
K500 | Ubiquitination | Uniprot | |
K510 | Ubiquitination | Uniprot | |
T512 | Phosphorylation | Uniprot | |
T514 | Phosphorylation | Uniprot | |
K520 | Ubiquitination | Uniprot | |
S547 | Phosphorylation | Uniprot |
Research Backgrounds
Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics. May modulate the cellular compartmentalization of AKT kinase family and promote its cell membrane localization, thereby playing a role in glucose transport in adipocytes.
Palmitoylation by ZDHHC17 regulates association with the plasma membrane.
Cell membrane>Lipid-anchor. Cytoplasm. Golgi apparatus>Golgi stack.
Note: Localized to Golgi stacks as well as on tubulovesicular elements juxtaposed to Golgi cisternae.
Homodimer. Interacts with AKT1 and AKT2; when AKT1 and AKT2 are phosphorylated and activated, affinity is higher for AKT2. Interacts with ZDHHC13 (via ANK repeats). Interacts with ZDHHC17 (via ANK repeats).
Microtubule association is inhibited by the ANK repeats and the Golgi localization region (GoLD).
References
Application: WB Species: rat Sample: spinal cord
Application: IF/ICC Species: rat Sample: astrocytes of the adult spinal cord
Application: IHC Species: rat Sample: spinal cord
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.