B4GALT5 Antibody - #DF3841
| Product: | B4GALT5 Antibody |
| Catalog: | DF3841 |
| Description: | Rabbit polyclonal antibody to B4GALT5 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 40 KD; 45kD(Calculated). |
| Uniprot: | O43286 |
| RRID: | AB_2836198 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3841, RRID:AB_2836198.
Fold/Unfold
4-galactosyltransferase 5; 4-GalT II; 4-GalTase 5; B4Gal T5; b4Gal-T5; B4galt5; B4GT5_HUMAN; Beta 1 4 galactosyltransferase 5; Beta 1 4 galactosyltransferase V; Beta 1 4 GalT II; Beta 1 4 GalT IV; Beta 1 4 GalTase 5; Beta-1; Beta-1,4-galactosyltransferase 5; Beta-1,4-GalT II; Beta-1,4-GalTase 5; Beta4 GALT IV; Beta4Gal T5; Beta4Gal-T5; Beta4GalT V; gt V; gtV; MGC138470; UDP Gal:beta GlcNAc beta 1 4 galactosyltransferase 5; UDP Gal:betaGlcNAc beta 1 4 galactosyltransferase 5; UDP Gal:betaGlcNAc beta 1 4 galactosyltransferase polypeptide 5; UDP galactose:beta N acetylglucosamine beta 1 4 galactosyltransferase 5; UDP-Gal:beta-GlcNAc beta-1; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5;
Immunogens
- O43286 B4GT5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43286 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T59 | O-Glycosylation | Uniprot | |
| T59 | Phosphorylation | Uniprot | |
| S71 | Phosphorylation | Uniprot | |
| Y73 | Phosphorylation | Uniprot | |
| K323 | Ubiquitination | Uniprot | |
| T375 | Phosphorylation | Uniprot | |
| Y388 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation (By similarity). Plays a role in the glycosylation of BMPR1A and regulation of its protein stability (By similarity). Essential for extraembryonic development during early embryogenesis (By similarity).
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Golgi apparatus.
Note: Trans cisternae of Golgi stack.
Ubiquitously expressed.
Belongs to the glycosyltransferase 7 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Mucin type O-glycan biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.