ATP5I Antibody - #DF3803
Product: | ATP5I Antibody |
Catalog: | DF3803 |
Description: | Rabbit polyclonal antibody to ATP5I |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 8 KD; 8kD(Calculated). |
Uniprot: | P56385 |
RRID: | AB_2836160 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3803, RRID:AB_2836160.
Fold/Unfold
ATP 5I; ATP 5K; ATP synthase e chain mitochondrial; ATP synthase H+ transporting mitochondrial F0 complex subunit E; ATP synthase subunit e; ATP synthase subunit e mitochondrial; ATP5I; ATP5I_HUMAN; ATP5K; ATPase subunit e; F1F0 ATP synthase murine e subunit; MGC12532; mitochondrial;
Immunogens
- P56385 ATP5I_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
PTMs - P56385 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S8 | Phosphorylation | Uniprot | |
Y25 | Phosphorylation | Uniprot | |
T28 | Phosphorylation | Uniprot | |
Y30 | Phosphorylation | Uniprot | |
Y32 | Phosphorylation | Uniprot | |
K34 | Acetylation | Uniprot | |
K34 | Ubiquitination | Uniprot | |
K49 | Ubiquitination | Uniprot | |
K50 | Ubiquitination | Uniprot | |
S66 | Phosphorylation | Uniprot | |
K69 | Acetylation | Uniprot | |
K69 | Ubiquitination | Uniprot |
Research Backgrounds
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
Mitochondrion. Mitochondrion inner membrane.
F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(0) seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L). Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5PD, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MD and ATP5MPL (By similarity).
Belongs to the ATPase e subunit family.
Research Fields
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.