AKR1B1 Antibody - #DF3759
(1)
(1)
| Product: | AKR1B1 Antibody |
| Catalog: | DF3759 |
| Description: | Rabbit polyclonal antibody to AKR1B1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 36 KD; 36kD(Calculated). |
| Uniprot: | P15121 |
| RRID: | AB_2836123 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3759, RRID:AB_2836123.
Fold/Unfold
ADR; AKR1B 1; Akr1b1; Aldehyde reductase 1; Aldehyde reductase; Aldo keto reductase family 1, member B1; Aldo-keto reductase family 1 member B1; aldo-keto reductase family 1, member B1 (aldose reductase); Aldose reductase; aldr 1; ALDR_HUMAN; aldr1; ALR2; AR; Lii5 2 CTCL tumor antigen; Low Km aldose reductase; MGC1804;
Immunogens
Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
- P15121 ALDR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15121 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| S3 | Phosphorylation | Uniprot | |
| K12 | Acetylation | Uniprot | |
| K12 | Ubiquitination | Uniprot | |
| T20 | Phosphorylation | Uniprot | |
| K22 | Ubiquitination | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| Y40 | Phosphorylation | Uniprot | |
| Y49 | Phosphorylation | Uniprot | |
| K62 | Ubiquitination | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| S77 | Phosphorylation | Uniprot | |
| Y83 | Phosphorylation | Uniprot | |
| K86 | Ubiquitination | Uniprot | |
| K90 | Ubiquitination | Uniprot | |
| K95 | Acetylation | Uniprot | |
| K95 | Ubiquitination | Uniprot | |
| S98 | Phosphorylation | Uniprot | |
| Y104 | Phosphorylation | Uniprot | |
| K117 | Acetylation | Uniprot | |
| K179 | Ubiquitination | Uniprot | |
| Y190 | Phosphorylation | Uniprot | |
| T192 | Phosphorylation | Uniprot | |
| K195 | Ubiquitination | Uniprot | |
| Y199 | Phosphorylation | Uniprot | |
| S211 | Phosphorylation | Uniprot | |
| S215 | Phosphorylation | Uniprot | |
| R218 | Methylation | Uniprot | |
| K222 | Acetylation | Uniprot | |
| K222 | Methylation | Uniprot | |
| K222 | Ubiquitination | Uniprot | |
| R233 | Methylation | Uniprot | |
| K240 | Ubiquitination | Uniprot | |
| K243 | Acetylation | Uniprot | |
| K243 | Ubiquitination | Uniprot | |
| K263 | Acetylation | Uniprot | |
| K263 | Ubiquitination | Uniprot | |
| S264 | Phosphorylation | Uniprot | |
| T266 | Phosphorylation | Uniprot | |
| C299 | S-Nitrosylation | Uniprot | |
| C304 | S-Nitrosylation | Uniprot | |
| K308 | Acetylation | Uniprot | |
| K308 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosacharides, bile acids and xenobiotics substrates. Key enzyme in the polyol pathway, catalyzes reduction of glucose to sorbitol during hyperglycemia. Reduces steroids and their derivatives and prostaglandins. Displays low enzymatic activity toward all-trans-retinal, 9-cis-retinal, and 13-cis-retinal. Catalyzes the reduction of diverse phospholipid aldehydes such as 1-palmitoyl-2-(5-oxovaleroyl)-sn -glycero-3-phosphoethanolamin (POVPC) and related phospholipid aldehydes that are generated from the oxydation of phosphotidylcholine and phosphatdyleethanolamides. Plays a role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls).
Cytoplasm.
Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
Monomer.
Belongs to the aldo/keto reductase family.
Research Fields
· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.
· Metabolism > Carbohydrate metabolism > Fructose and mannose metabolism.
· Metabolism > Carbohydrate metabolism > Galactose metabolism.
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Folate biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.