AKR1C2 Antibody - #DF3757
| Product: | AKR1C2 Antibody |
| Catalog: | DF3757 |
| Description: | Rabbit polyclonal antibody to AKR1C2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 37 KD; 37kD(Calculated). |
| Uniprot: | P52895 |
| RRID: | AB_2836121 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3757, RRID:AB_2836121.
Fold/Unfold
2-dihydrobenzene-1; 2-diol dehydrogenase; 3 alpha HSD3; 3 alpha hydroxysteroid dehydrogenase type III; 3-alpha-HSD3; AK1C2_HUMAN; AKR1C pseudo; AKR1C2; Aldo keto reductase family 1 member C2; Aldo-keto reductase family 1 member C2; BABP; Bile acid binding protein; Chlordecone reductase homolog; Chlordecone reductase homolog HAKRD; DD; DD-2; DD/BABP; DD2; DDH 2; DDH2; Dihydrodiol dehydrogenase 2; Dihydrodiol dehydrogenase/bile acid binding protein; Dihydrodiol dehydrogenase/bile acid-binding protein; FLJ53800; HAKRD; HBAB; MCDR 2; MCDR2; OTTHUMP00000044759; Pseudo chlordecone reductase; SRXY8; Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase; Trans-1; Type II dihydrodiol dehydrogenase; Type III 3 alpha hydroxysteroid dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase;
Immunogens
- P52895 AK1C2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
PTMs - P52895 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K4 | Acetylation | Uniprot | |
| K4 | Sumoylation | Uniprot | |
| K4 | Ubiquitination | Uniprot | |
| Y5 | Phosphorylation | Uniprot | |
| K9 | Sumoylation | Uniprot | |
| K9 | Ubiquitination | Uniprot | |
| T23 | Phosphorylation | Uniprot | |
| Y24 | Phosphorylation | Uniprot | |
| K31 | Ubiquitination | Uniprot | |
| K33 | Ubiquitination | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| S73 | Phosphorylation | Uniprot | |
| K75 | Acetylation | Uniprot | |
| K75 | Sumoylation | Uniprot | |
| K75 | Ubiquitination | Uniprot | |
| Y81 | Phosphorylation | Uniprot | |
| T82 | Phosphorylation | Uniprot | |
| S83 | Phosphorylation | Uniprot | |
| K84 | Ubiquitination | Uniprot | |
| K104 | Sumoylation | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| Y110 | Phosphorylation | Uniprot | |
| K123 | Ubiquitination | Uniprot | |
| K131 | Sumoylation | Uniprot | |
| T141 | Phosphorylation | Uniprot | |
| K161 | Acetylation | Uniprot | |
| K161 | Ubiquitination | Uniprot | |
| S162 | Phosphorylation | Uniprot | |
| K179 | Acetylation | Uniprot | |
| K179 | Ubiquitination | Uniprot | |
| K183 | Ubiquitination | Uniprot | |
| Y184 | Phosphorylation | Uniprot | |
| K185 | Ubiquitination | Uniprot | |
| Y196 | Phosphorylation | Uniprot | |
| K201 | Ubiquitination | Uniprot | |
| K207 | Ubiquitination | Uniprot | |
| S208 | Phosphorylation | Uniprot | |
| K209 | Ubiquitination | Uniprot | |
| S232 | Phosphorylation | Uniprot | |
| K246 | Acetylation | Uniprot | |
| K246 | Ubiquitination | Uniprot | |
| K247 | Acetylation | Uniprot | |
| K247 | Ubiquitination | Uniprot | |
| K270 | Acetylation | Uniprot | |
| K270 | Ubiquitination | Uniprot | |
| Y272 | Phosphorylation | Uniprot | |
| K294 | Ubiquitination | Uniprot | |
| Y305 | Phosphorylation | Uniprot | |
| Y317 | Phosphorylation | Uniprot |
Research Backgrounds
Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.
Cytoplasm.
Expressed in fetal testes. Expressed in fetal and adult adrenal glands.
Belongs to the aldo/keto reductase family.
Research Fields
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.