ARL2BP Antibody - #DF3749
| Product: | ARL2BP Antibody |
| Catalog: | DF3749 |
| Description: | Rabbit polyclonal antibody to ARL2BP |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 25 KD; 19kD(Calculated). |
| Uniprot: | Q9Y2Y0 |
| RRID: | AB_2836113 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3749, RRID:AB_2836113.
Fold/Unfold
ADP ribosylation factor like 2 binding protein; ADP-ribosylation factor-like protein 2-binding protein; AR2BP_HUMAN; Arf like 2 binding protein BART1; ARF-like 2-binding protein; ARL2 binding protein; Arl2bp; ARL2BP protein; BART; BART1; Binder of ARF2 protein 1; Binder of Arl Two; Binder of Arl2; Retinitis pigmentosa 66 (autosomal recessive); RP66;
Immunogens
Expressed in retina pigment epithelial cells (at protein level). Widely expressed.
- Q9Y2Y0 AR2BP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2Y0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y128 | Phosphorylation | Uniprot | |
| S140 | Phosphorylation | Uniprot | |
| K150 | Ubiquitination | Uniprot | |
| S151 | Phosphorylation | Uniprot | |
| S153 | Phosphorylation | Uniprot | |
| S157 | Phosphorylation | Uniprot | |
| R162 | Methylation | Uniprot |
Research Backgrounds
Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
Cytoplasm. Mitochondrion intermembrane space. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Nucleus. Cytoplasm>Cytoskeleton>Spindle. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: The complex formed with ARL2BP, ARL2 and SLC25A4 is expressed in mitochondria (By similarity). Detected in the midbody matrix. Not detected in the Golgi, nucleus and on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. In retina photoreceptor cells, localized in the distal connecting cilia, basal body, ciliary-associated centriole, and ciliary rootlet. Interaction with ARL2 may be required for cilia basal body localization.
Expressed in retina pigment epithelial cells (at protein level). Widely expressed.
Found in a complex with ARL2BP, ARL2 and SLC25A6. Found in a complex with ARL2, ARL2BP and SLC25A4. Interacts with STAT2, STAT3 and STAT4. Interacts with GTP-bound ARL2 and ARL3; the complex ARL2-ARL2BP as well as ARL2BP alone, binds to ANT1. Interaction with ARL2 may be required for targeting to cilia basal body. Interacts with STAT3; interaction is enhanced with ARL2.
Belongs to the ARL2BP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.