BST1 Antibody - #DF3744
Product: | BST1 Antibody |
Catalog: | DF3744 |
Description: | Rabbit polyclonal antibody to BST1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Rabbit, Dog, Chicken |
Mol.Wt.: | 34 KD; 36kD(Calculated). |
Uniprot: | Q10588 |
RRID: | AB_2836108 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3744, RRID:AB_2836108.
Fold/Unfold
ADP ribosyl cyclase 2; ADP-ribosyl cyclase 2; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; Bone marrow stromal antigen 1; Bone marrow stromal cell antigen 1; BST 1; BST-1; BST1; BST1_HUMAN; cADPr hydrolase 2; CD157; CD157 antigen; Cyclic ADP ribose hydrolase 2; Cyclic ADP-ribose hydrolase 2; NAD(+) nucleosidase; OTTHUMP00000217617;
Immunogens
- Q10588 BST1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q10588 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N95 | N-Glycosylation | Uniprot | |
N192 | N-Glycosylation | Uniprot | |
Y263 | Phosphorylation | Uniprot |
Research Backgrounds
Synthesizes the second messengers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth.
Cell membrane>Lipid-anchor.
Widely expressed.
Homodimer.
Belongs to the ADP-ribosyl cyclase family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Pancreatic secretion.
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.